BioLiP

>protein
FLEEEFEINLSVKHLLELWDKNLLNTFEIGTFKGLSQIHSYMFKDIFDFNGQIRNVNISKNNSMFCLARYLKQNLEIIDN
MKHDTFDQIIDKYVEMNICHPFREGNGRSMRIWLDLILKKQLNVVVNWTNINKDEYLLAMINSLIDSTNLKLLIKNNLTN
KITDRNVYIKSIIKSYEYEGFKINIK

The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8idw:B	186	186	1.0000	1.0000	1.0000	1.48e-133	8idw:A, 8idw:C, 8idw:D
2	6ep2:K	204	175	0.4892	0.4461	0.5200	2.97e-59	6ep0:A, 6ep0:B, 6ep2:A, 6ep2:B, 6ep2:C, 6ep2:D, 6ep2:E, 6ep2:F, 6ep2:G, 6ep2:H, 6ep2:I, 6ep2:J, 6ep2:L, 6ep5:A, 6ep5:B, 6ep5:C, 6ep5:D, 6ep5:E, 6ep5:F
3	3s6a:A	178	172	0.4570	0.4775	0.4942	3.00e-55	3se5:A, 3se5:B, 3se5:C, 3se5:D, 3sn9:A, 3sn9:B, 3sn9:C, 3sn9:D, 3sn9:E, 3sn9:F, 3sn9:G, 3sn9:H, 3sn9:I, 3sn9:J, 3sn9:K, 3sn9:L, 3sn9:M, 3sn9:N, 3sn9:O, 3sn9:P, 3zlm:A
4	2f6s:A	180	170	0.4194	0.4333	0.4588	7.13e-42	2f6s:B
5	3zc7:A	199	166	0.2688	0.2513	0.3012	7.29e-16	3zcb:A
6	2jk8:A	291	228	0.2634	0.1684	0.2149	3.99e-07	5nh2:A
7	4wgj:A	210	136	0.1559	0.1381	0.2132	2.45e-04
8	4n67:A	214	123	0.1452	0.1262	0.2195	0.006
9	4itr:A	299	69	0.0968	0.0602	0.2609	0.92	4itr:B, 3n3u:A, 6siu:B, 6siu:A
10	7eoz:A	482	66	0.0968	0.0373	0.2727	1.2	7eoz:B
11	3s1s:A	870	59	0.0914	0.0195	0.2881	1.8
12	7cb8:A	394	84	0.0968	0.0457	0.2143	2.2	7cb8:B
13	8ei4:A	365	83	0.1183	0.0603	0.2651	2.3
14	1a0e:A	443	70	0.1237	0.0519	0.3286	2.8	1a0e:D
15	4x2d:A	227	42	0.0753	0.0617	0.3333	4.4
16	7b7z:A	340	18	0.0538	0.0294	0.5556	6.6	7b80:A, 6i7g:A, 6i7g:B, 6i7i:A, 6i7k:A, 6i7l:A, 4u07:A, 4u07:B, 4u0s:A, 4u0s:B, 4u0u:A, 4u0u:B, 4u0z:A, 4u0z:B, 4u0z:C, 4u0z:D, 4u0z:E, 4u0z:F, 4u0z:G, 4u0z:H, 6zmd:B

[Back]