BioLiP

>protein
FHVNKSGFPIDSHTWERMWLHVAKVHPRGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGT
QFFEIRKMRPLSGLMETAKEMTRESLPIKALEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGYYGSLG
MSRRAELMDKPLTFRTLSDLVFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYAR
DMRMKILKPAS

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6jze:A	254	251	0.9960	0.9843	0.9960	0.0	6j4p:A, 6j4q:J, 6j4q:A, 6j4q:F, 6j4q:C, 6j4v:A, 6jzd:A, 6qby:A, 7zcw:C
2	6j7b:A	249	246	0.6096	0.6145	0.6220	8.90e-114	6j4u:A, 6j8f:B, 6j8n:B, 6j8n:D, 6j8o:B, 6j91:B, 6j9h:B, 6j9h:D, 6k81:A, 6lpg:A, 6nvq:C, 6ocg:A, 6och:A, 6och:C
3	2wyo:C	496	69	0.0797	0.0403	0.2899	0.66	2wyo:B, 2wyo:D
4	3h94:A	297	42	0.0598	0.0505	0.3571	1.1	3h94:B, 3opo:A, 3opo:B, 3ow7:A, 3ow7:B
5	2wyo:A	520	76	0.0837	0.0404	0.2763	1.6
6	7cvo:A	130	35	0.0558	0.1077	0.4000	5.3	7c9o:C, 7cvq:A, 7cvq:F, 7cvq:K, 7cvq:P
7	8tri:B	454	34	0.0478	0.0264	0.3529	5.7	7suu:A, 7suu:B, 8tri:A
8	8tri:C	419	34	0.0478	0.0286	0.3529	6.3
9	1ehi:A	360	62	0.0598	0.0417	0.2419	7.3
10	5vt8:C	211	34	0.0478	0.0569	0.3529	7.8	5vt8:B, 5vt8:A, 5vt8:D
11	6agk:F	309	69	0.0876	0.0712	0.3188	8.1	5fnv:F, 6gf3:F, 6jcj:F, 5jqg:F, 5xhc:F, 5xi5:F, 5xi7:F, 5yl4:F, 5z4u:F, 5zxh:F

[Back]