Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
FEISDGVEFDLNPLVLAISFLGWSLPGLLPSNIPLYGGKGLTTALFAEIGEHLQTFPAPPPIGDPFWVILFIWHSGLFAT
MIFGTIGYNGYGPKSTTKY

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7y7b:O 99 99 1.0000 1.0000 1.0000 4.24e-67 7y8a:O
2 8wm6:O 104 93 0.6465 0.6154 0.6882 8.43e-40 8wmv:O, 8wmw:O
3 7y5e:ON 92 89 0.4848 0.5217 0.5393 6.53e-32 7y5e:O2, 7y7a:O7, 7y7a:Oo
4 6fos:O 98 92 0.4747 0.4796 0.5109 5.67e-28 7blz:O, 8wey:O, 5zgb:O, 5zgh:O
5 8wgh:O 89 87 0.3636 0.4045 0.4138 3.97e-15
6 8j6z:O 86 84 0.3636 0.4186 0.4286 9.80e-15
7 6sl5:O 86 82 0.3232 0.3721 0.3902 7.82e-14
8 6zzx:O 87 78 0.3232 0.3678 0.4103 2.91e-12
9 7dz7:O 97 79 0.3030 0.3093 0.3797 7.54e-12 7d0j:O, 7dz8:O
10 8htu:O 90 87 0.3131 0.3444 0.3563 1.46e-11 7ksq:O, 7ku5:O, 7xqp:O
11 7yca:O 96 80 0.2929 0.3021 0.3625 1.90e-10
12 5zji:O 76 87 0.2828 0.3684 0.3218 4.06e-07
13 7w02:A 1566 35 0.1313 0.0083 0.3714 0.48
14 8yjx:A 558 17 0.1010 0.0179 0.5882 3.3
15 8yjx:B 490 17 0.1010 0.0204 0.5882 3.5
16 8xqw:A 988 45 0.1616 0.0162 0.3556 5.5

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218