EYKGHSGHPLILKQEGEYKGYSGEPLILKQEGEYKGYSGTPLILEQKGEYQSFSGTPLILKQEGEYRGFSGAPLILKQDG
EYKSFSGYPLLLNI
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7zcu:S | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 1.43e-60 | 7zdi:S, 7ze3:S, 7ze8:S |
2 | 8zc9:A | 1000 | 53 | 0.1489 | 0.0140 | 0.2642 | 0.48 | 8wyc:C, 8wyc:D, 8wyf:C, 8wyf:D, 8ylt:A, 8ylt:B, 8ylt:C, 8ylt:D, 8zc9:D |
3 | 8zc9:B | 971 | 53 | 0.1489 | 0.0144 | 0.2642 | 0.49 | 8wyb:A, 8wyb:B, 8wyb:C, 8wyb:D, 8wyc:A, 8wyc:B, 8wyf:A, 8wyf:B, 8zc9:E |
4 | 1bwu:D | 109 | 72 | 0.1489 | 0.1284 | 0.1944 | 1.6 | 1bwu:Q |
5 | 7u8v:A | 454 | 40 | 0.1170 | 0.0242 | 0.2750 | 1.8 | 7u8w:A, 7u8x:A, 7ulk:B, 5y3n:A |
6 | 7c05:A | 435 | 40 | 0.1170 | 0.0253 | 0.2750 | 1.8 | 7c7c:A, 7u8u:A, 7u8u:B, 7ulk:A, 5y3o:A, 4z1f:A, 4z1g:A, 4z1h:A |
7 | 5tth:A | 671 | 73 | 0.2021 | 0.0283 | 0.2603 | 6.0 | 6d14:A, 7exp:A, 4ipe:A, 4ivg:A, 4iyn:A, 4j0b:A, 4mli:A, 4mli:C, 4mls:A, 5tvu:A, 5tvw:A, 5tvx:A |
8 | 7qok:A | 1361 | 60 | 0.1596 | 0.0110 | 0.2500 | 7.1 | |
9 | 2e7u:A | 424 | 74 | 0.2447 | 0.0542 | 0.3108 | 8.2 | |
10 | 5i92:F | 420 | 25 | 0.1170 | 0.0262 | 0.4400 | 9.1 | |
11 | 5ln8:A | 123 | 35 | 0.1170 | 0.0894 | 0.3143 | 9.4 |