EVYSEKMFTESERTYFMNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENMNEFESNLLKAIAVIKQKVST
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3nm7:A | 84 | 74 | 0.9595 | 0.8452 | 0.9595 | 2.98e-47 | 3n8b:A, 3n8b:B |
2 | 5fgp:A | 144 | 58 | 0.2027 | 0.1042 | 0.2586 | 0.99 | |
3 | 1tah:B | 318 | 35 | 0.1486 | 0.0346 | 0.3143 | 5.1 | 1cvl:A, 2es4:A, 2es4:B, 1qge:E, 1tah:A, 1tah:C, 1tah:D |
4 | 5n6n:C | 698 | 41 | 0.1892 | 0.0201 | 0.3415 | 5.9 | 5m4a:A |