EVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQSLLVNLRAMQNFLQLPEAERDRIYQDERE
RSLR
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2o49:A | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 1.77e-56 | 6lff:A, 6lff:B, 2o4a:A |
2 | 2d5v:A | 135 | 69 | 0.3214 | 0.2000 | 0.3913 | 5.43e-07 | 2d5v:B, 8t0f:A, 8t11:A |
3 | 6brh:B | 502 | 70 | 0.2381 | 0.0398 | 0.2857 | 0.56 | 6brg:A, 6brg:B, 6brg:C, 6brg:D, 6brh:A, 6brk:A |
4 | 7d0j:J | 41 | 31 | 0.1548 | 0.3171 | 0.4194 | 1.1 | 7bgi:J, 7blx:J, 7dz7:J, 7dz8:J, 8h2u:J, 6ijj:J, 6ijo:J, 6jo5:J, 6jo6:J, 7r3k:J, 7wyi:J, 7wzn:J, 7zq9:J, 7zqc:J, 7zqd:J, 7zqd:J2 |
5 | 8cls:A | 837 | 24 | 0.1071 | 0.0108 | 0.3750 | 4.0 | |
6 | 1gr3:A | 132 | 35 | 0.1667 | 0.1061 | 0.4000 | 5.1 |