EVQFGAYLAVLLGTFLPALFLVNLFIQTEARKAGKAGGQDS
The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8j5k:M | 41 | 41 | 1.0000 | 1.0000 | 1.0000 | 1.56e-23 | 8j5k:m |
2 | 8xlp:m | 38 | 37 | 0.5854 | 0.6316 | 0.6486 | 2.04e-12 | |
3 | 7y5e:ML | 42 | 36 | 0.6098 | 0.5952 | 0.6944 | 1.35e-11 | 7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm |
4 | 8wb4:M | 36 | 35 | 0.5122 | 0.5833 | 0.6000 | 2.48e-10 | 8wb4:m |
5 | 4yuu:m2 | 40 | 33 | 0.5122 | 0.5250 | 0.6364 | 2.96e-08 | 4yuu:m1, 4yuu:M2 |
6 | 8wql:MD | 36 | 32 | 0.2927 | 0.3333 | 0.3750 | 0.077 | 8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE |
7 | 3a0b:M | 36 | 35 | 0.2683 | 0.3056 | 0.3143 | 0.16 | 3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M |
8 | 2c1d:B | 137 | 27 | 0.2683 | 0.0803 | 0.4074 | 0.98 | 2c1d:D, 2c1d:F, 2c1d:H |
9 | 7ymi:M | 31 | 24 | 0.2439 | 0.3226 | 0.4167 | 1.4 | 7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M |
10 | 1u38:A | 89 | 40 | 0.3171 | 0.1461 | 0.3250 | 2.9 | |
11 | 8tow:M | 31 | 22 | 0.2439 | 0.3226 | 0.4545 | 5.3 | 8tow:m |
12 | 2o2c:A | 564 | 18 | 0.2195 | 0.0160 | 0.5000 | 8.9 | 2o2c:B, 2o2c:C |