BioLiP

>protein
EVFDNELVSYEGVDWEKIPNRFKRRRMPLSDEVMDEWKIPYRERDYCVHKLLELRKCVQKTFYRGECDHHRHEYHMCQHL
ELRRRKAIKDLREELGR

The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8j9h:B7	97	97	1.0000	1.0000	1.0000	4.50e-68	8j9i:B7, 8j9j:B7
2	6tmh:B	479	47	0.1753	0.0355	0.3617	0.24	6tmh:D, 6tmk:B2, 6tmk:D2, 6tmk:B1, 6tmk:D1
3	3pdi:B	432	35	0.1031	0.0231	0.2857	2.3	3pdi:D, 3pdi:F, 3pdi:H
4	1y7b:A	534	24	0.1031	0.0187	0.4167	2.4	1y7b:B, 1y7b:C, 1y7b:D, 1yi7:A, 1yi7:B, 1yi7:C, 1yi7:D
5	6gk5:A	403	51	0.1753	0.0422	0.3333	2.4	6gk6:A
6	5xyi:a	100	28	0.1237	0.1200	0.4286	2.9
7	7xvr:A	389	35	0.1443	0.0360	0.4000	3.4	7xvr:B, 7xvu:A, 7xvu:B, 7xvv:A, 7xvv:B, 7xvw:A, 7xvw:B
8	4b6z:B	382	42	0.1340	0.0340	0.3095	4.5	4b6z:A, 4b6z:C, 4b6z:D
9	6k1l:A	382	40	0.1340	0.0340	0.3250	5.1	6k1l:B, 6k1l:C, 6k1l:D, 6k1m:A, 6k1m:B, 6k1m:C, 6k1m:D, 6k1n:A, 6k1n:B, 6k1n:C, 6k1n:D
10	4n83:A	285	50	0.1753	0.0596	0.3400	5.5	4n83:B, 4n83:C, 4n83:D, 4n83:E, 4n83:F, 4n83:G, 4n83:H
11	6qzk:A	746	56	0.1753	0.0228	0.3036	6.3
12	4mgz:E	632	22	0.0928	0.0142	0.4091	7.0	3cf6:E, 4mgi:E, 4mgk:E, 4mgy:E, 4mh0:E
13	5fpx:B	107	20	0.0928	0.0841	0.4500	7.4	5fpx:A
14	5e3x:A	489	41	0.1340	0.0266	0.3171	7.5
15	2bcg:G	442	42	0.1443	0.0317	0.3333	9.1	1ukv:G

[Back]