EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3orc:A | 65 | 65 | 1.0000 | 1.0000 | 1.0000 | 2.51e-44 | 6cro:A |
2 | 2pij:A | 59 | 63 | 0.3846 | 0.4237 | 0.3968 | 4.61e-07 | |
3 | 8v9l:z | 375 | 66 | 0.3538 | 0.0613 | 0.3485 | 0.79 | 8v9j:z |
4 | 3kzh:A | 316 | 24 | 0.1385 | 0.0285 | 0.3750 | 3.1 | 3kzh:B |
5 | 8dq2:A | 110 | 32 | 0.2154 | 0.1273 | 0.4375 | 3.5 | 8dq2:B, 8dq2:C, 8dq2:D, 8fnr:A, 8fnr:B, 8fnr:C, 8fnr:D |
6 | 8uhe:K | 593 | 47 | 0.2462 | 0.0270 | 0.3404 | 3.8 | |
7 | 1g82:A | 157 | 25 | 0.1231 | 0.0510 | 0.3200 | 6.1 | |
8 | 3ue1:A | 604 | 28 | 0.2000 | 0.0215 | 0.4643 | 6.5 | 3udi:A, 3udi:B, 3udx:A, 3udx:B, 3ue0:A, 3ue0:B, 3ue1:B |
9 | 6m8n:A | 367 | 32 | 0.1846 | 0.0327 | 0.3750 | 7.8 |