BioLiP

>protein
EQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEA
LKIYLSKYRE

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7aw7:B	92	90	1.0000	0.9783	1.0000	8.30e-63	7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H
2	4awl:B	92	90	0.7667	0.7500	0.7667	2.19e-49	7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B
3	6r2v:B	93	90	0.7444	0.7204	0.7444	7.23e-49	7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q
4	7c9o:B	85	85	0.6889	0.7294	0.7294	3.64e-43
5	1jfi:B	135	80	0.3333	0.2222	0.3750	3.87e-14
6	4wzs:B	113	75	0.2889	0.2301	0.3467	1.44e-09
7	1a7w:A	68	64	0.2444	0.3235	0.3438	1.57e-04	5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F
8	6qmq:C	84	69	0.2556	0.2738	0.3333	0.003	7ah8:B, 7ah8:D, 4awl:C, 6qmp:C, 6qms:C, 8qu2:C, 8qu3:C, 8qu4:C
9	7aw9:C	118	65	0.2333	0.1780	0.3231	0.006	7aw7:C, 4g91:C, 4g92:C, 6y35:C, 6y36:C, 6y37:C, 6y39:C, 6y39:F, 6y39:I
10	7d69:D	96	41	0.1556	0.1458	0.3415	0.32	7d69:H
11	7d69:B	78	66	0.1667	0.1923	0.2273	0.69	7d69:F
12	8jcc:H	94	49	0.1333	0.1277	0.2449	0.77	8jcc:D, 8jcd:D, 8jcd:H
13	8je1:A	675	61	0.1556	0.0207	0.2295	0.81
14	6kxv:E	95	67	0.1778	0.1684	0.2388	2.6	6kxv:A
15	7shl:A	645	60	0.1556	0.0217	0.2333	3.1
16	7vfs:A	1266	45	0.1111	0.0079	0.2222	4.1	7vfu:A, 7vfv:A, 7vfw:A
17	5glg:A	471	44	0.1444	0.0276	0.2955	7.5	6ku6:B, 6ku6:H, 5zyn:B
18	3ez2:B	394	71	0.2556	0.0584	0.3239	8.9	3ez2:A, 3ez6:A, 3ez6:B

[Back]