EPRINVGSRFQAEIPLMRDRALAAADPHKADLVWQPWEDLESSREKQRQVEDLLTAACSSIFPGAGTNQELALHCLHESR
GDILETLNKLLLKKPLRPHNHPLATYHYTGWKMAERKLFNKGIAIYKKDFFLVQKLIQTKTVAQCVEFYYTYKKQVK
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6z2k:J | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 3.49e-118 | |
2 | 5ij7:B | 469 | 117 | 0.2166 | 0.0725 | 0.2906 | 2.59e-04 | 6b3w:A, 6b3w:B, 6c23:K, 6c24:K, 5ij7:A, 5ij8:A, 5ij8:B, 4w2r:A, 4w2r:B |
3 | 4a69:C | 69 | 45 | 0.1019 | 0.2319 | 0.3556 | 0.003 | 4a69:D |
4 | 1ey2:A | 419 | 74 | 0.1465 | 0.0549 | 0.3108 | 0.90 | |
5 | 8h7g:K | 352 | 40 | 0.1019 | 0.0455 | 0.4000 | 3.5 | |
6 | 4xj2:A | 162 | 59 | 0.1210 | 0.1173 | 0.3220 | 3.8 | |
7 | 6jgz:B | 3485 | 43 | 0.0892 | 0.0040 | 0.3256 | 8.4 | 6jg3:A, 6jg3:B, 6jg3:C, 6jg3:D, 6jgz:D, 6jgz:F, 6jgz:H, 6jh6:B, 6jh6:D, 6jh6:F, 6jh6:H, 6jhn:A, 6jhn:C, 6jhn:E, 6jhn:G, 6ji0:A, 6ji0:C, 6ji0:E, 6ji0:G, 6jrr:A, 6jrr:C, 6jrr:E, 6jrr:G |
8 | 7cm1:B | 387 | 26 | 0.0764 | 0.0310 | 0.4615 | 9.1 | 7cm1:A, 7fgb:A, 7fgb:B, 7fgc:A, 7fgc:B, 7fgd:A, 7fgd:B, 7fge:A, 7fge:B, 7fge:C, 7fge:D, 7fge:E, 7fge:F, 7fge:G, 7fge:H |