EPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3a0b:L | 37 | 36 | 1.0000 | 0.9730 | 1.0000 | 3.65e-19 | 3a0b:l, 5b66:L, 7czl:L, 7czl:l, 7dxh:l, 7eda:L, 5mx2:L, 5mx2:l, 7nhp:L, 7nhq:L, 4pj0:L, 4pj0:l |
2 | 7y5e:L6 | 37 | 35 | 0.8333 | 0.8108 | 0.8571 | 5.56e-16 | 7y5e:l6, 7y7a:LO, 7y7a:lO, 7y7a:LZ, 7y7a:lZ, 4yuu:l2, 4yuu:L2 |
3 | 7vd5:L | 38 | 35 | 0.8333 | 0.7895 | 0.8571 | 9.81e-16 | 8j5k:L, 8j5k:l, 7vd5:l, 8xlp:L |
4 | 8wql:LD | 38 | 33 | 0.8056 | 0.7632 | 0.8788 | 6.86e-15 | 8wql:LE, 8wql:L1 |
5 | 7pi0:L | 38 | 36 | 0.7778 | 0.7368 | 0.7778 | 4.70e-14 | 7pi0:l, 7pi5:l, 7pin:l, 7pin:L1, 7piw:L, 7piw:L1, 7pnk:l |
6 | 5xnm:L | 37 | 36 | 0.7778 | 0.7568 | 0.7778 | 7.32e-14 | 5mdx:L, 5mdx:l, 7oui:L, 7oui:l, 5xnm:l |
7 | 7ymi:L | 36 | 35 | 0.8333 | 0.8333 | 0.8571 | 8.95e-10 | 7ymi:l, 7ymm:1L, 7ymm:2L, 7ymm:3L, 7ymm:4L |
8 | 6wj6:L | 31 | 31 | 0.7500 | 0.8710 | 0.8710 | 1.56e-05 | |
9 | 3o5b:A | 479 | 33 | 0.3611 | 0.0271 | 0.3939 | 0.44 | 3o5b:B, 3o80:A, 3o8m:A |
10 | 7xnk:A | 348 | 21 | 0.3056 | 0.0316 | 0.5238 | 3.8 | 7tci:A, 7tci:G, 7tci:E, 7tci:C, 4umo:A, 6v01:A, 6v01:J, 6v01:D, 6v01:G, 7xnk:C, 7xnk:E, 7xnk:G, 7xnl:A, 7xnl:C, 7xnl:E, 7xnl:G, 7xnn:B, 7xnn:G, 7xnn:C, 7xnn:E |