BioLiP

>protein
EPKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRMHLTGMEGEGLKEIAEDARLEDRLHFELMTQRIYELGG
GLPRDIRQLADISACSDAYLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAWFLEL
LYGRPSGH

The query sequence (length=168) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2clb:A	169	168	1.0000	0.9941	1.0000	5.27e-123	2clb:B, 2clb:C, 2clb:D, 2clb:M, 2clb:N, 2clb:O, 2clb:P
2	7stw:A	170	154	0.6250	0.6176	0.6818	1.34e-73	7stw:B, 7stw:C, 7stw:D, 7stw:E, 7stw:F, 7stw:G, 7stw:H, 7stw:I, 7stw:J, 7stw:K, 7stw:L
3	2vzb:A	168	149	0.2917	0.2917	0.3289	1.35e-12	2vzb:B, 2vzb:C, 2vzb:D
4	8w1e:B	172	146	0.2321	0.2267	0.2671	0.032	8w1d:A, 8w1e:A, 8w1e:C, 8w1e:D, 8w1e:E, 8w1e:F, 8w1e:G, 8w1e:H, 8w1e:I, 8w1e:J, 8w1e:K, 8w1e:L, 8w1f:A, 8w1f:B, 8w1f:C, 8w1f:D, 8w1f:E, 8w1f:F, 8w1f:G, 8w1f:H, 8w1f:I, 8w1f:J, 8w1f:K, 8w1f:L
5	7s8t:J	83	51	0.1012	0.2048	0.3333	1.1	7s8t:A, 7s8t:E, 7s8t:F, 7s8t:H, 7s8t:G, 7s8t:I
6	6kf9:C	388	36	0.0952	0.0412	0.4444	3.7	9bct:C, 9bcu:C
7	3nzq:A	628	64	0.1131	0.0303	0.2969	6.1	3nzq:B
8	1nf6:F	171	142	0.2083	0.2047	0.2465	9.9	1nf4:A, 1nf4:B, 1nf4:C, 1nf4:D, 1nf4:E, 1nf4:F, 1nf4:G, 1nf4:H, 1nf4:I, 1nf4:J, 1nf4:K, 1nf4:L, 1nf4:M, 1nf4:N, 1nf4:O, 1nf4:P, 1nf6:A, 1nf6:B, 1nf6:C, 1nf6:D, 1nf6:E, 1nf6:G, 1nf6:H, 1nf6:I, 1nf6:J, 1nf6:K, 1nf6:L, 1nf6:M, 1nf6:N, 1nf6:O, 1nf6:P, 1nfv:A, 1nfv:B, 1nfv:C, 1nfv:D, 1nfv:E, 1nfv:F, 1nfv:G, 1nfv:H, 1nfv:I, 1nfv:J, 1nfv:K, 1nfv:L, 1nfv:M, 1nfv:N, 1nfv:O, 1nfv:P

[Back]