BioLiP

>protein
EKSMPFIKHLASSDRKVRTAALNSLHAFLSARQVASALTTLDVLKLWKGLFYALWMCDRAIPQQNLCNELADLIWQLPRE
SVATWLRGFWATMAREWTGIDVLRMEKFLLLVRRVLGASFKWMKKGAWDQSKVDEVLGLLAEWPFSLAEEVRITQSSEKG
GEIVQKIPVGMRLHVLDIWVDEVERVGLLNEDEEEARMIVQRISDMVDALEQTTKSPAVRTRSKDSLGDDRLPANR

The query sequence (length=236) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i9p:Cc	236	236	1.0000	1.0000	1.0000	1.25e-173	6emf:B, 8i9r:Cc, 8i9t:Cc, 8i9v:Cc
2	6c0f:z	243	249	0.3517	0.3416	0.3333	1.29e-36	8e5t:z, 6em1:4, 6em3:4, 6em4:4, 7ohs:4, 7ohw:4, 7ohx:4, 8v83:w, 8v84:w
3	8ev3:4	211	185	0.3051	0.3412	0.3892	3.02e-33	8eti:4
4	5z3g:X	202	234	0.3263	0.3812	0.3291	2.48e-30
5	8fkp:NO	305	183	0.2500	0.1934	0.3224	1.14e-22	8fkr:NO, 8fkt:NO, 8fkv:NO
6	4ii3:A	986	113	0.1144	0.0274	0.2389	0.11	9b5c:A, 9b5d:A, 9b5e:A, 9b5f:A, 9b5g:A, 9b5h:A, 9b5i:A, 9b5j:A, 9b5k:A, 9b5l:A, 9b5m:A, 9b5n:A, 9b5o:A, 9b5p:A, 9b5q:A, 9b5r:A, 9b5s:A, 9b5t:A, 9b5u:A, 9b5v:A, 9b5w:A, 9b5x:A, 4ii2:A, 4ii3:C, 6o82:A, 6o82:C, 6o83:A, 6o83:C, 5um6:A
7	6ru4:A	276	64	0.0678	0.0580	0.2500	2.3	6r5s:A, 6r5s:B, 6ru4:B, 6ru4:C, 6ru4:D
8	6s2e:A	1006	58	0.0805	0.0189	0.3276	3.5	6s2f:A
9	3f11:A	316	37	0.0551	0.0411	0.3514	6.3	2pt2:A
10	1mje:A	600	49	0.0763	0.0300	0.3673	9.1

[Back]