EIVKIPVVVHVVWNEEEENISDAQIQSQIDILNKDFRKLNSDVSQVPSVWSNLIADLGIEFFLATKDPNGNQTTGITRTQ
TSVTFFTTSDEVKFASSGGEDAWPADRYLNIWVCHVLKSEIGQDILGYAQFPGGPAETDGVVIVDAAFGTTGTALPPFDK
GRTATHEIGHWLNLYHIWGDELRFEDPCSRSDEVDDTPNQADPNFGCPSYPHVSCSNGPNGDMFMNYCDYVDDKCMVMFT
QGQATRVNACLDGPRSSFL
The query sequence (length=259) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8cdb:A | 306 | 259 | 0.9923 | 0.8399 | 0.9923 | 0.0 | 8cd8:A, 8cd8:C, 8cdb:B, 8cdb:C, 8cdb:D, 8cdb:E, 8cdb:F, 8cdb:G, 8cdb:H, 8cdb:I, 8cdb:J, 8cdb:K, 8cdb:L, 8cdb:M, 8cdb:N, 2cki:A, 2cki:B, 2j83:A, 2j83:B, 3lum:A, 3lum:B, 3lum:C, 3lum:D, 3lun:A, 3lun:B |
2 | 6r7u:B | 308 | 255 | 0.5290 | 0.4448 | 0.5373 | 2.58e-89 | 7od0:AAA, 7od0:BBB, 7od0:CCC, 7od0:DDD, 7od0:EEE, 7od0:FFF, 6r7u:A, 6r7v:A, 6r7w:A |
3 | 8sl1:A | 843 | 268 | 0.2587 | 0.0795 | 0.2500 | 3.04e-06 | |
4 | 8hgg:C | 1484 | 130 | 0.1467 | 0.0256 | 0.2923 | 3.18e-05 | 8hgg:D, 8hgh:A, 8hgh:B |
5 | 8a7e:C | 1524 | 130 | 0.1429 | 0.0243 | 0.2846 | 8.40e-05 | 8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B |
6 | 7ufg:B | 1182 | 130 | 0.1429 | 0.0313 | 0.2846 | 1.32e-04 | 8d8o:B |
7 | 7ufg:A | 1151 | 130 | 0.1429 | 0.0321 | 0.2846 | 1.41e-04 | |
8 | 1wni:A | 198 | 38 | 0.0579 | 0.0758 | 0.3947 | 1.4 | |
9 | 7tbj:A5 | 1276 | 38 | 0.0463 | 0.0094 | 0.3158 | 3.7 | 5hax:A, 5hb0:B, 5hb0:C, 5hb0:A, 7tbi:A1, 7tbi:A2, 7tbi:A3, 7tbi:A4, 7tbj:A1, 7tbj:A3, 7tbj:A6, 7tbk:A1, 7tbk:A3, 7tbk:A5, 7tbk:A6, 7tbl:A1, 7tbl:A3, 7tbl:A5, 7tbl:A6, 7tbm:A1, 7tbm:A3, 7tbm:A5, 7tbm:A6 |
10 | 7tbj:A2 | 1269 | 38 | 0.0463 | 0.0095 | 0.3158 | 3.8 | 7tbj:A4, 7tbk:A2, 7tbk:A4, 7tbl:A2, 7tbl:A4, 7tbm:A2, 7tbm:A4 |
11 | 7sva:A | 792 | 61 | 0.0695 | 0.0227 | 0.2951 | 3.9 | 7swf:A, 7swq:A |
12 | 3rg0:A | 292 | 61 | 0.0734 | 0.0651 | 0.3115 | 6.2 | |
13 | 5hb0:D | 502 | 38 | 0.0463 | 0.0239 | 0.3158 | 6.6 | |
14 | 4kx4:A | 217 | 31 | 0.0502 | 0.0599 | 0.4194 | 7.0 | 7d9l:A, 7dkp:A, 7dkp:B, 7dkp:C, 7dkp:D |
15 | 1fdj:A | 363 | 70 | 0.0656 | 0.0468 | 0.2429 | 9.5 | 1fdj:B |
16 | 8gap:H | 384 | 42 | 0.0502 | 0.0339 | 0.3095 | 9.6 |