EGDGSAPGGSVWQTTDYIALSMVVYRTAIKLRNFVNIRGLTPTEMIVIPWNVMRFYCEYNTGTYGLSGNVHHKNYSMLLA
The query sequence (length=334) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6wh3:A |
334 |
334 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
6wh3:B, 6wh3:C, 6wh3:D, 6wh3:E, 6wh3:F, 6wh3:G, 6wh3:H, 6wh3:I, 6wh3:J, 6wh3:K, 6wh3:L, 6wh3:M, 6wh3:N, 6wh3:O, 6wh3:P, 6wh3:Q, 6wh3:R, 6wh3:S, 6wh3:T, 6wh3:U, 6wh3:V, 6wh3:W, 6wh3:X, 6wh3:Y, 6wh3:Z, 6wh3:8, 6wh3:7, 6wh3:6, 6wh3:5, 6wh3:4, 6wh3:3, 6wh3:a, 6wh3:b, 6wh3:c, 6wh3:d, 6wh3:e, 6wh3:f, 6wh3:g, 6wh3:h, 6wh3:i, 6wh3:j, 6wh3:k, 6wh3:l, 6wh3:m, 6wh3:n, 6wh3:o, 6wh3:p, 6wh3:q, 6wh3:r, 6wh3:s, 6wh3:t, 6wh3:u, 6wh3:v, 6wh3:w, 6wh3:x, 6wh3:y, 6wh3:z, 6wh3:1, 6wh3:2 |
2 |
5x9u:A |
494 |
33 |
0.0329 |
0.0223 |
0.3333 |
1.1 |
5x9u:B, 5x9u:C, 5x9u:D, 5x9v:A, 5x9v:B, 5x9v:C, 5x9v:D |
3 |
8bam:A |
525 |
90 |
0.0778 |
0.0495 |
0.2889 |
1.2 |
8bam:B, 8bap:A, 8bap:B, 8bap:C, 8bap:D, 8bap:E, 8bap:F, 8bap:G, 8bap:H, 8bap:I, 8bap:J, 8bap:K, 8bap:L, 8bap:M, 8bap:N, 8bap:O, 8bap:P, 5fxd:A, 5fxd:B, 5fxe:A, 5fxe:B, 5fxf:A, 5fxf:B, 5fxp:A, 5fxp:B, 7ywu:A, 7ywu:B, 7ywu:C, 7ywu:D, 7ywu:E, 7ywu:F, 7ywu:G, 7ywu:H, 7ywv:A, 7ywv:B, 7ywv:C, 7ywv:D, 7ywv:E, 7ywv:F, 7ywv:G, 7ywv:H |
4 |
3uhf:A |
255 |
124 |
0.0868 |
0.1137 |
0.2339 |
1.9 |
3uhf:B, 3uho:A, 3uho:B |
5 |
5m7h:A |
420 |
98 |
0.0659 |
0.0524 |
0.2245 |
2.7 |
4dcs:A, 4dct:A, 4dcu:A, 2hjg:A, 5mbs:A, 5x4b:A, 5x4b:B |
6 |
1mdx:A |
366 |
40 |
0.0449 |
0.0410 |
0.3750 |
5.0 |
1mdo:A, 1mdz:A, 4oca:A |
7 |
6m73:A |
364 |
58 |
0.0449 |
0.0412 |
0.2586 |
6.1 |
6m74:A |
8 |
3n7x:A |
299 |
196 |
0.1198 |
0.1338 |
0.2041 |
7.5 |
|
9 |
8j0t:C |
534 |
62 |
0.0389 |
0.0243 |
0.2097 |
8.5 |
8j0s:A, 8j0s:B, 8j0s:C, 8j0t:A, 8j0t:B, 8jr0:A, 8jr0:B, 8jr0:C |