EFNVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGQLLPRWYFYYLGTGPHAKDQY
GTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEG
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4kxj:A | 135 | 134 | 1.0000 | 0.9778 | 0.9851 | 8.76e-94 | 4li4:A, 4lm7:A, 4lm9:A, 4lmc:A, 4lmt:A |
2 | 7acs:A | 140 | 128 | 0.4545 | 0.4286 | 0.4688 | 7.88e-30 | 7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D |
3 | 6lz8:B | 130 | 126 | 0.4091 | 0.4154 | 0.4286 | 7.91e-27 | 6kl5:A, 6kl6:B |
4 | 6lz8:D | 112 | 124 | 0.3712 | 0.4375 | 0.3952 | 2.73e-22 | 7dyd:D, 6kl5:C, 6kl6:D, 6lnn:D, 6lz6:D |
5 | 6wkp:A | 103 | 121 | 0.3788 | 0.4854 | 0.4132 | 6.56e-21 | |
6 | 8em7:A | 4378 | 23 | 0.0833 | 0.0025 | 0.4783 | 1.5 | 8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B |
7 | 8uw3:A | 1265 | 49 | 0.1061 | 0.0111 | 0.2857 | 1.7 | 7n8s:A, 7n94:A, 7n94:B, 8sp5:A, 8sp5:B, 8sp7:A, 8sxt:A, 8sxu:A, 1vyb:B |
8 | 8em4:A | 3818 | 23 | 0.0833 | 0.0029 | 0.4783 | 1.8 | 8em4:B |
9 | 5oe3:A | 394 | 53 | 0.1515 | 0.0508 | 0.3774 | 2.8 | 5oe3:B, 5oe3:C, 5oe3:D, 5oe4:A, 5oe4:B, 5oe5:A, 5oe6:A, 5oe6:B, 5oe6:C, 5oe6:D |
10 | 5k8e:A | 473 | 35 | 0.0985 | 0.0275 | 0.3714 | 3.5 | 5l6f:A, 5l6g:A |
11 | 2ixu:A | 338 | 64 | 0.1136 | 0.0444 | 0.2344 | 5.9 | 2ixv:A, 2j8f:A, 2j8g:A, 1oba:A |
12 | 2itm:A | 476 | 58 | 0.1439 | 0.0399 | 0.3276 | 6.1 | 2itm:B |
13 | 4wv3:B | 518 | 85 | 0.2045 | 0.0521 | 0.3176 | 6.1 | 4wv3:A |
14 | 5wu3:B | 485 | 47 | 0.1136 | 0.0309 | 0.3191 | 8.3 | 5wu2:A, 5wu2:B, 5wu3:A, 5wu4:A, 5wu4:B |
15 | 3c5m:B | 378 | 94 | 0.1515 | 0.0529 | 0.2128 | 8.8 | 3c5m:A, 3c5m:C |
16 | 6azq:G | 226 | 58 | 0.1288 | 0.0752 | 0.2931 | 9.4 | 6azq:H, 6azq:A, 6azq:B, 6azq:C, 6azq:D, 6azq:E, 6azs:B, 6azs:D |
17 | 7m7f:A | 1390 | 16 | 0.0682 | 0.0065 | 0.5625 | 9.7 | 2fr0:A, 2fr1:A, 7m7i:A |