BioLiP

>protein
EFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTHELKEVLNKVK

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2q5z:B	94	80	0.9875	0.8404	0.9875	4.76e-53	2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D
2	7mu5:A	110	63	0.2750	0.2000	0.3492	0.001	7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G
3	6sqw:A	114	66	0.2625	0.1842	0.3182	0.007	2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D
4	5ie9:C	95	64	0.2625	0.2211	0.3281	0.012	5ie9:A, 5ie9:B, 5ie9:D
5	4qgp:A	108	50	0.2250	0.1667	0.3600	0.11	4qgp:B
6	4cg4:C	376	27	0.1500	0.0319	0.4444	0.61	4cg4:D, 4cg4:E, 4cg4:F
7	4po6:A	475	67	0.2500	0.0421	0.2985	0.63
8	7cdw:A	683	53	0.2625	0.0307	0.3962	0.63	7cdw:B
9	7ody:C	100	68	0.2625	0.2100	0.3088	0.67	7ody:A, 7ody:B, 7ody:D
10	3tr9:A	277	88	0.3250	0.0939	0.2955	2.5	3tr9:B, 3tr9:C, 3tr9:D
11	4v4n:AZ	99	56	0.2250	0.1818	0.3214	4.4	4v6u:BZ
12	4y9d:A	235	25	0.1500	0.0511	0.4800	5.1
13	2ivn:A	325	42	0.1875	0.0462	0.3571	5.2	2ivo:A, 2ivo:B, 2ivo:C, 2ivp:A
14	1ky8:A	499	24	0.1375	0.0220	0.4583	7.1	1uxn:A, 1uxp:A, 1uxq:A, 1uxr:A, 1uxt:A, 1uxu:A, 1uxv:A
15	4qfh:B	611	25	0.1375	0.0180	0.4400	8.3	4qfh:A
16	4ilk:A	337	26	0.1500	0.0356	0.4615	9.3	4ilk:B

[Back]