EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK
The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1bi6:H | 41 | 41 | 1.0000 | 1.0000 | 1.0000 | 2.11e-24 | 2bi6:H |
2 | 7fin:R | 380 | 37 | 0.2683 | 0.0289 | 0.2973 | 0.47 | 7dty:R, 7fiy:R, 7rbt:R, 7vab:R, 8yw4:R |
3 | 7p5z:G | 213 | 16 | 0.1220 | 0.0235 | 0.3125 | 0.99 | |
4 | 5g5s:A | 692 | 33 | 0.3171 | 0.0188 | 0.3939 | 1.2 | 5g5t:A |
5 | 3h0g:M | 1476 | 16 | 0.1951 | 0.0054 | 0.5000 | 3.5 | |
6 | 7d4i:RJ | 738 | 19 | 0.1951 | 0.0108 | 0.4211 | 4.1 | 7d5t:RJ, 6lqs:RJ, 6lqt:RJ |
7 | 7krg:F | 270 | 25 | 0.2439 | 0.0370 | 0.4000 | 5.2 | 3gdf:A, 3gdf:B, 7krg:A, 7krg:B, 7krg:C, 7krg:D, 7krg:E, 7krg:G, 7krg:H |
8 | 7ajt:CL | 781 | 16 | 0.1951 | 0.0102 | 0.5000 | 5.3 | 7d5s:RJ, 6zqa:CL, 6zqb:CL, 6zqc:CL |
9 | 7suk:SI | 802 | 16 | 0.1951 | 0.0100 | 0.5000 | 5.3 | 7d63:RJ, 6ke6:RJ, 6lqp:RJ, 6lqq:RJ, 6lqr:RJ, 6lqu:RJ, 6lqv:RJ, 5wlc:SI |
10 | 7aju:CL | 808 | 16 | 0.1951 | 0.0099 | 0.5000 | 5.3 | 6zqd:CL, 6zqe:CL, 6zqf:CL, 6zqg:CL |