EEQTFSWSEISQHTSANSLWVVVRDKTSPGSPLRVYDVTNFQKTHPGGHLILLKYAGTECSRAFAAVGHSKYAIKRMSQY
RIGIAEAD
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7bwh:A | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 1.27e-63 | |
| 2 | 3ner:B | 91 | 79 | 0.3523 | 0.3407 | 0.3924 | 1.31e-14 | 3ner:A |
| 3 | 3ozz:B | 82 | 79 | 0.3068 | 0.3293 | 0.3418 | 3.43e-13 | |
| 4 | 2ibj:A | 86 | 79 | 0.2955 | 0.3023 | 0.3291 | 3.62e-13 | |
| 5 | 1awp:A | 86 | 79 | 0.3068 | 0.3140 | 0.3418 | 5.90e-13 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
| 6 | 2i89:A | 90 | 79 | 0.3182 | 0.3111 | 0.3544 | 1.87e-12 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
| 7 | 1aw3:A | 94 | 79 | 0.3182 | 0.2979 | 0.3544 | 2.89e-11 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
| 8 | 2i96:A | 108 | 84 | 0.3068 | 0.2500 | 0.3214 | 2.35e-10 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
| 9 | 1hko:A | 104 | 79 | 0.2841 | 0.2404 | 0.3165 | 2.76e-10 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
| 10 | 4b8n:B | 90 | 74 | 0.2386 | 0.2333 | 0.2838 | 4.57e-08 | 4b8n:A, 4b8n:C, 4b8n:D |
| 11 | 1x3x:A | 82 | 86 | 0.2955 | 0.3171 | 0.3023 | 3.68e-07 | 1x3x:B |
| 12 | 8tgb:A | 108 | 62 | 0.2273 | 0.1852 | 0.3226 | 1.10e-06 | 8tgb:B |
| 13 | 1cxy:A | 81 | 83 | 0.2500 | 0.2716 | 0.2651 | 4.25e-06 | |
| 14 | 1mj4:A | 79 | 78 | 0.3068 | 0.3418 | 0.3462 | 2.28e-05 | |
| 15 | 1kbi:A | 504 | 63 | 0.2159 | 0.0377 | 0.3016 | 1.91e-04 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
| 16 | 3lf5:A | 87 | 60 | 0.1818 | 0.1839 | 0.2667 | 5.50e-04 | 3lf5:B |
| 17 | 1sox:A | 463 | 56 | 0.2273 | 0.0432 | 0.3571 | 0.001 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
| 18 | 7bmu:A | 115 | 50 | 0.1818 | 0.1391 | 0.3200 | 0.11 | 7bmv:A, 7bmw:A, 7bmx:A, 7bmy:A |
| 19 | 6ysy:A | 767 | 20 | 0.1250 | 0.0143 | 0.5500 | 1.3 | |
| 20 | 8z1r:B | 516 | 49 | 0.1477 | 0.0252 | 0.2653 | 2.3 | 8z1r:A |
| 21 | 4alc:A | 166 | 39 | 0.1250 | 0.0663 | 0.2821 | 7.3 | 4ale:A, 4alq:A, 4alr:A, 4als:A, 4alt:A |
| 22 | 6twe:A | 172 | 36 | 0.1023 | 0.0523 | 0.2500 | 9.6 |
umich.edu