EEIFIGVAWPFASLDDLFAEGLELAVQEINEQGGVQGRKLSLVKADDEAELEKGLAIAQAFADNAGIQAVIGHRNSFISI
PAASIYDQAGLVMLSPASTSPDLTDHGYIHVFRNIPSDQEIARQLAIYLAEQGHERMVIYYTDDSYGNGLANAFEDYARA
QGITIVDRFNYYGNLKDLERLYDKWQAFGMDGIFIAKTATGGGTEFLVDAKSVGIEVPLIAGNSWDAMTAEGLLVGSFFN
PQRPDSRTQDFVEAFRREYGQPPTSYAAAGYDAVILLAEALEKSDLTHPATLAQGLRDLGPWEGVMGMHRFDGRGDDIGD
LVVLKKMKDGRFEYL
The query sequence (length=335) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4mlc:A | 336 | 336 | 1.0000 | 0.9970 | 0.9970 | 0.0 | 4q6b:A |
2 | 1usi:A | 345 | 318 | 0.2925 | 0.2841 | 0.3082 | 9.49e-32 | 1usi:C, 1usk:A, 1usk:D, 1usk:B, 1usk:C |
3 | 1z16:A | 344 | 321 | 0.2925 | 0.2849 | 0.3053 | 8.62e-30 | 1z17:A, 1z18:A |
4 | 3ip5:A | 348 | 349 | 0.2896 | 0.2787 | 0.2779 | 3.02e-28 | 3ip6:A, 3ip7:A, 3ip9:A, 3ipa:A, 3ipc:A |
5 | 4n0q:B | 345 | 333 | 0.2746 | 0.2667 | 0.2763 | 1.00e-26 | 4n0q:A, 4n0q:C, 4n0q:D |
6 | 4gnr:A | 348 | 326 | 0.2299 | 0.2213 | 0.2362 | 2.31e-23 | |
7 | 3td9:A | 350 | 329 | 0.2597 | 0.2486 | 0.2644 | 5.83e-19 | |
8 | 4q6w:A | 376 | 351 | 0.2418 | 0.2154 | 0.2308 | 9.62e-11 | 4q6w:B |
9 | 8wch:A | 396 | 377 | 0.2269 | 0.1919 | 0.2016 | 1.54e-08 | 8wch:B |
10 | 4eyg:B | 364 | 308 | 0.1940 | 0.1786 | 0.2110 | 7.89e-07 | 4eyg:A |
11 | 3i45:A | 378 | 347 | 0.2478 | 0.2196 | 0.2392 | 1.19e-06 | |
12 | 1qo0:B | 374 | 284 | 0.1970 | 0.1765 | 0.2324 | 1.19e-06 | 1pea:A, 1qnl:A, 1qo0:A |
13 | 3lop:A | 353 | 201 | 0.1463 | 0.1388 | 0.2438 | 5.71e-06 | |
14 | 4nqr:A | 364 | 306 | 0.1612 | 0.1484 | 0.1765 | 9.74e-06 | 4nqr:B, 4nv3:A, 4nv3:B, 4oat:A, 4oat:B, 4obb:A, 4obb:B, 4og2:A, 4og2:B, 4otz:A, 4otz:B, 4qym:A, 4qym:B, 4rdc:A, 4rv5:A, 4rv5:B |
15 | 6e5v:B | 447 | 120 | 0.1045 | 0.0783 | 0.2917 | 7.39e-05 | 6bsz:A, 6bsz:B, 6bt5:A, 6bt5:B, 6e5v:A |
16 | 8tao:B | 771 | 114 | 0.0866 | 0.0376 | 0.2544 | 9.15e-05 | 7fd8:A, 7fd8:B, 7fd9:A, 7fd9:B, 3lmk:A, 3lmk:B, 8t8m:A |
17 | 6n51:B | 793 | 109 | 0.0866 | 0.0366 | 0.2661 | 9.21e-05 | 6n4x:B, 6n4y:C, 6n50:A, 6n50:B, 6n50:C, 6n51:A, 8t6j:B, 8t6j:A, 8t7h:A, 8t7h:B, 8t8m:B, 8tao:A |
18 | 8jd6:R | 774 | 119 | 0.1045 | 0.0452 | 0.2941 | 2.79e-04 | 7e9h:R, 7e9h:S, 8jd4:4, 8jd5:4, 8jd6:S |
19 | 4zpj:A | 371 | 314 | 0.2299 | 0.2075 | 0.2452 | 6.23e-04 | |
20 | 5c5c:A | 432 | 140 | 0.1104 | 0.0856 | 0.2643 | 0.001 | |
21 | 7lzh:A | 798 | 290 | 0.1910 | 0.0802 | 0.2207 | 0.002 | 7lzh:B, 7lzh:C, 7lzh:D, 7lzi:A, 7lzi:B, 7lzi:C, 7lzi:D |
22 | 4dqd:A | 361 | 168 | 0.1104 | 0.1025 | 0.2202 | 0.002 | 3sg0:A |
23 | 5ere:A | 540 | 297 | 0.2179 | 0.1352 | 0.2458 | 0.002 | |
24 | 8tr2:A | 745 | 155 | 0.1343 | 0.0604 | 0.2903 | 0.003 | 2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B |
25 | 7dge:A | 784 | 109 | 0.0836 | 0.0357 | 0.2569 | 0.008 | 1ewk:A, 1ewk:B, 1isr:A, 1iss:A, 1iss:B, 3ks9:A, 3ks9:B |
26 | 8jd5:2 | 785 | 148 | 0.1224 | 0.0522 | 0.2770 | 0.009 | 5cni:A, 5cni:B, 5cnj:A, 5cnj:B, 7e9g:R, 7e9g:S, 8jcu:2, 8jcv:2, 8jcw:2, 8jcx:2, 8jcy:2, 8jcz:2, 8jd0:2, 8jd1:2, 8jd2:2, 8jd3:2, 5kzn:A, 5kzq:A, 7mtr:B, 7mtr:A, 7mts:A, 7mts:B, 4xaq:A, 4xaq:B, 4xas:A, 4xas:B |
27 | 8jcu:3 | 765 | 156 | 0.1313 | 0.0575 | 0.2821 | 0.011 | 6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A |
28 | 7cum:B | 675 | 107 | 0.1045 | 0.0519 | 0.3271 | 0.012 | 7c7q:B, 6w2x:B, 6wiv:B |
29 | 7mtq:B | 744 | 122 | 0.1104 | 0.0497 | 0.3033 | 0.012 | 8jd4:2 |
30 | 6uo8:B | 696 | 107 | 0.1045 | 0.0503 | 0.3271 | 0.015 | 7ca3:B, 7eb2:D |
31 | 7epb:A | 779 | 101 | 0.0925 | 0.0398 | 0.3069 | 0.096 | 7epb:B, 7mtq:A |
32 | 6oe7:A | 258 | 58 | 0.0537 | 0.0698 | 0.3103 | 0.31 | 6oea:A, 6oeb:A, 6oov:A |
33 | 3mq4:A | 386 | 77 | 0.0746 | 0.0648 | 0.3247 | 0.83 | |
34 | 4fyg:A | 743 | 40 | 0.0448 | 0.0202 | 0.3750 | 3.0 | 4fye:A, 4fyf:A |
35 | 6c75:A | 378 | 78 | 0.0627 | 0.0556 | 0.2692 | 6.5 | 6c75:B, 6c76:A, 6c7l:A |
36 | 3a74:A | 484 | 29 | 0.0388 | 0.0269 | 0.4483 | 8.2 | 3a74:B, 3a74:C, 3a74:D, 3e9h:A, 3e9h:B, 3e9h:C, 3e9h:D, 3e9i:A, 3e9i:B, 3e9i:C, 3e9i:D |
37 | 9bh5:AO | 135 | 75 | 0.0746 | 0.1852 | 0.3333 | 9.4 | 9cai:AO |