EEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
The query sequence (length=39) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8k2a:Lp | 97 | 39 | 1.0000 | 0.4021 | 1.0000 | 3.71e-25 | 8k2b:Lp, 7og4:a, 8xt0:Lp, 8xt1:Lp, 8xt2:Lp, 8xt3:Lp, 6zs9:a, 6zsa:a, 6zsb:a, 6zsc:a, 6zsd:a, 6zse:a, 6zsg:a |
| 2 | 6i9r:a | 83 | 39 | 1.0000 | 0.4699 | 1.0000 | 4.78e-25 | 7a5f:a3, 7a5g:a3, 7a5h:a, 7a5i:a3, 7a5j:a, 7a5k:a3, 3j9m:a, 6nu2:a, 6nu3:a, 7o9k:a, 7o9m:a, 7of0:a, 7of2:a, 7of3:a, 7of4:a, 7of5:a, 7of6:a, 7of7:a, 7oi6:a, 7oi7:a, 7oi8:a, 7oi9:a, 7oia:a, 7oib:a, 7oic:a, 7oid:a, 7oie:a, 5ool:a, 5oom:a, 7pd3:a, 7qh6:a, 7qh7:a, 8qu5:a |
| 3 | 7l08:a | 108 | 39 | 1.0000 | 0.3611 | 1.0000 | 5.47e-25 | 8any:a, 3j7y:a, 7l20:a, 7odr:a, 7ods:a, 7odt:a, 8oir:Br, 8oit:Br, 8pk0:a, 7po4:a, 7qi4:a, 7qi5:a, 7qi6:a, 8qsj:a, 6vlz:a, 6vmi:a, 6zm5:a, 6zm6:a |
| 4 | 6gaw:Bf | 108 | 39 | 0.8205 | 0.2963 | 0.8205 | 2.11e-18 | 6gb2:Bf, 7nqh:Bf, 7nql:Bf, 7nsh:Bf, 7nsi:Bf, 7nsj:Bf, 8oin:Br, 8oiq:Br, 6ydp:Bf, 6ydw:Bf |
| 5 | 5aj4:Bf | 108 | 39 | 0.8205 | 0.2963 | 0.8205 | 2.60e-18 | |
| 6 | 8byi:A | 320 | 21 | 0.1795 | 0.0219 | 0.3333 | 1.5 | 8byi:B, 8byi:C, 8byi:D, 8byi:E |
| 7 | 5wbj:A | 1058 | 33 | 0.2821 | 0.0104 | 0.3333 | 6.1 | 5wbk:A, 5wbl:A |
| 8 | 6f4v:A | 341 | 18 | 0.2051 | 0.0235 | 0.4444 | 7.7 | |
| 9 | 2zze:A | 744 | 15 | 0.2308 | 0.0121 | 0.6000 | 7.9 | 2zze:B, 2zzf:A, 2zzg:A, 2zzg:B |
| 10 | 4oxi:A | 526 | 23 | 0.2051 | 0.0152 | 0.3478 | 9.8 |
zhanggroup.org