EEFQQIPDFYGCYLLQSISKRQSFYIGSTPNPVRRLRQHNGSLSRRDGTRPWEMVAIVYGFPSRIAALQFQHAWQHGYQT
RYVKTRKGGRSIHHKLAMITSLLKNEYFRYMDLTLHFFNQKVEEIWKNDKFNVSQNNYTVSLSQDALTEINNDTIDDIMD
VNEKNMELVQNLYSTTLAEKTKTLLLYKEKIDTGINTCQFCNKIINLFAFCRDTSCTFVSHLACAYRYFMSNEDTIIPQS
PKCPKCYTLLKWCDVIYYSIKLNKDNT
The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4xm5:A | 267 | 267 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4xlg:A |
2 | 7cq2:A | 274 | 275 | 0.4682 | 0.4562 | 0.4545 | 2.20e-90 | |
3 | 7cq3:A | 298 | 291 | 0.4757 | 0.4262 | 0.4364 | 4.91e-90 | 7cq2:B, 7cq4:A |
4 | 6sei:A | 276 | 272 | 0.3071 | 0.2971 | 0.3015 | 1.01e-35 | 6sei:C |
5 | 6seh:C | 252 | 259 | 0.3071 | 0.3254 | 0.3166 | 2.09e-33 | 6seh:A |
6 | 4zdt:C | 70 | 57 | 0.0712 | 0.2714 | 0.3333 | 0.004 | 4zdt:A |
7 | 5hvq:C | 236 | 175 | 0.1236 | 0.1398 | 0.1886 | 0.007 | 5wy5:A |
8 | 2ct0:A | 74 | 59 | 0.0599 | 0.2162 | 0.2712 | 0.007 | |
9 | 3ldf:A | 380 | 58 | 0.0637 | 0.0447 | 0.2931 | 1.2 | |
10 | 7od3:A | 1012 | 53 | 0.0637 | 0.0168 | 0.3208 | 4.1 | 7od3:B, 7od3:C |
11 | 3qe6:B | 286 | 91 | 0.0787 | 0.0734 | 0.2308 | 4.4 | 3qe6:A |
12 | 3jcm:G | 734 | 118 | 0.1199 | 0.0436 | 0.2712 | 7.0 | 5zwm:N, 5zwo:N |
13 | 6y2x:A | 231 | 48 | 0.0524 | 0.0606 | 0.2917 | 7.0 | 6ir0:A, 6y22:A, 6y3j:A |
14 | 8xuu:A | 431 | 49 | 0.0599 | 0.0371 | 0.3265 | 7.8 | |
15 | 8xus:B | 1063 | 49 | 0.0599 | 0.0151 | 0.3265 | 8.1 | 8if2:B |