EDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFF
IGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3abk:Q | 144 | 139 | 1.0000 | 0.9653 | 1.0000 | 8.14e-102 | 3abm:Q, 5b1b:Q, 7coh:D, 7coh:Q, 7cp5:D, 7cp5:Q, 7d5w:D, 7d5w:Q, 7d5x:D, 7d5x:Q, 2dys:D, 2ein:Q, 8gbt:Q, 8gcq:D, 8gcq:Q, 8h8r:D, 8h8r:Q, 8h8s:D, 8h8s:Q, 6juw:D, 6juw:Q, 6nkn:Q, 6nmf:Q, 6nmp:Q, 7tih:D, 7tih:Q, 7vuw:Q, 5w97:d, 7y44:D, 7y44:Q, 2y69:Q, 7ypy:D, 7ypy:Q |
2 | 1rdf:A | 263 | 43 | 0.1007 | 0.0532 | 0.3256 | 2.3 | 1fez:A, 1fez:B, 1fez:C, 1fez:D, 2iof:A, 2iof:K, 2ioh:A, 2ioh:B, 2ioh:C, 2ioh:D, 1rdf:B, 1rdf:C, 1rdf:D, 1rdf:E, 1rdf:F, 1rql:A, 1rql:B, 1rqn:A, 1rqn:B, 1swv:A, 1swv:B, 1sww:A, 1sww:B |
3 | 5b7j:A | 111 | 34 | 0.0863 | 0.1081 | 0.3529 | 2.6 | |
4 | 8sam:A | 859 | 24 | 0.0863 | 0.0140 | 0.5000 | 7.1 | 8sam:B, 8sao:B, 8sao:D |
5 | 5xoo:B | 351 | 41 | 0.0935 | 0.0370 | 0.3171 | 8.8 | 5xoo:A |
6 | 5a8a:A | 155 | 57 | 0.1007 | 0.0903 | 0.2456 | 9.1 | 5a88:A, 5a88:B, 5a88:C, 5a88:D, 5a89:A, 5a89:B, 5a8a:B |