EDANERIAELVKLEERQRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGI
RLKDELINIKQILEAAIMFIYEEEENISLLNENILSMCLKEAVTNVVKHSQAKRVDIQQLWKEVVITVSDDGTFKGEENS
FSKGHGLLGMRERLEFANGSLHITENLTMAIPNNS
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ssj:A | 219 | 205 | 1.0000 | 0.8904 | 0.9512 | 2.08e-131 | 3ehf:A, 3ehf:D, 3ehg:A, 3ehh:A, 3ehh:B, 3ehj:A, 3ehj:B, 3gie:A, 3gie:B, 3gif:A, 3gig:A, 3gig:B, 5iuj:A, 5iuj:B, 5iuj:D, 5iuj:E, 5iuk:A, 5iuk:B, 5iuk:D, 5iuk:E, 5iul:A, 5iul:B, 5iul:D, 5iul:E, 5ium:A, 5ium:B, 7ssi:A, 7ssi:B, 7ssi:D, 7ssi:E, 7ssj:C, 7ssj:D |
2 | 8sbm:B | 126 | 78 | 0.1179 | 0.1825 | 0.2949 | 0.003 | 8sbm:A, 3zxo:A, 3zxo:B |
3 | 4gt8:A | 133 | 75 | 0.0974 | 0.1429 | 0.2533 | 0.044 | |
4 | 6qig:A | 581 | 77 | 0.1077 | 0.0361 | 0.2727 | 0.074 | 3ghm:A, 3ghn:A, 3vn4:A |
5 | 2xsj:A | 436 | 69 | 0.1077 | 0.0482 | 0.3043 | 3.7 | 2xsj:D |
6 | 6q8n:A | 321 | 41 | 0.0769 | 0.0467 | 0.3659 | 4.2 | 6q8n:B |
7 | 7oya:C1 | 348 | 113 | 0.1231 | 0.0690 | 0.2124 | 4.7 | 7oyb:C1 |
8 | 8k1o:B | 215 | 59 | 0.0872 | 0.0791 | 0.2881 | 6.4 | 8k1o:C, 8k1p:B, 8k1p:C |