BioLiP

>protein
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEK
DVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL

The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3d9k:B	141	137	1.0000	0.9716	1.0000	3.64e-100	3d9k:A, 3d9l:A, 3d9l:B, 3d9m:A, 3d9m:B, 3d9n:A, 3d9n:B, 3d9o:B, 3d9p:A, 3d9p:B
2	6xkb:C	139	136	0.8029	0.7914	0.8088	1.22e-78	6xkb:B, 6xkb:A, 6xkb:E, 6xkb:D
3	1sza:B	140	119	0.2482	0.2429	0.2857	7.28e-07	2bf0:X
4	2mow:A	161	138	0.2336	0.1988	0.2319	8.00e-06	6gc3:A, 2lo6:A, 6o3w:A, 6o3w:B, 6o3x:A, 6o3x:B, 6o3x:C, 6o3y:A, 6o3y:B, 6o3y:C
5	4q94:A	129	90	0.1752	0.1860	0.2667	2.43e-04	9b9l:A, 4q94:B, 4q96:A, 4q96:B, 4q96:D, 4q96:E
6	4jxt:A	130	95	0.1679	0.1769	0.2421	4.65e-04
7	5lvf:A	142	136	0.2409	0.2324	0.2426	0.006	2l0i:A, 5m9d:A
8	4js4:A	468	40	0.0949	0.0278	0.3250	2.1	3c94:A, 4hcb:A, 4hcb:B, 4hcc:A, 4hcc:B, 3hl8:A, 3hp9:A, 4jrp:A, 4jrp:B, 4jrq:A, 4jrq:B, 4js4:B, 4js5:A, 4js5:B
9	2qxf:A	433	40	0.0949	0.0300	0.3250	2.2
10	7wbt:A	899	90	0.1314	0.0200	0.2000	2.5	7wbt:B, 7wbu:A
11	6itu:A	146	55	0.0803	0.0753	0.2000	3.9
12	2v64:A	210	89	0.1825	0.1190	0.2809	6.3	6f0x:Z, 1klq:A, 2qyf:A, 2qyf:C, 2v64:F, 2v64:C
13	2p20:A	641	38	0.1022	0.0218	0.3684	7.2	5jrh:A, 5jrh:B, 2p20:B, 2p2b:A, 2p2b:B, 2p2f:A, 2p2f:B, 2p2j:A, 2p2j:B, 2p2m:A, 2p2m:B, 2p2q:A, 2p2q:B, 1pg3:A, 1pg3:B, 1pg4:A, 1pg4:B
14	8hgg:C	1484	22	0.0949	0.0088	0.5909	7.5	8hgg:D, 8hgh:A, 8hgh:B
15	8a7e:C	1524	22	0.0949	0.0085	0.5909	7.5	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
16	3zxs:A	508	44	0.0949	0.0256	0.2955	9.1	3zxs:B, 3zxs:C

[Back]