EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ktm:E | 177 | 59 | 0.9661 | 0.3220 | 0.9661 | 1.42e-38 | 2fk1:A, 2fk2:A, 2fk3:A, 2fk3:H, 2fk3:E, 2fk3:F, 4jfn:A, 3ktm:A, 3ktm:B, 3ktm:C, 3ktm:D, 3ktm:F, 3ktm:G, 3ktm:H |
2 | 6dfu:A | 332 | 42 | 0.2203 | 0.0392 | 0.3095 | 2.2 | 6dfu:B |
3 | 6dlh:A | 704 | 17 | 0.1695 | 0.0142 | 0.5882 | 4.5 | 6dms:A, 6dns:A |
4 | 3va8:A | 427 | 32 | 0.1525 | 0.0211 | 0.2812 | 7.4 | |
5 | 2qhs:A | 210 | 21 | 0.1525 | 0.0429 | 0.4286 | 7.5 | 2qhu:A, 2qhv:A |
6 | 4buc:A | 427 | 21 | 0.1356 | 0.0187 | 0.3810 | 8.6 | 4buc:B |
7 | 3gjb:B | 271 | 32 | 0.2034 | 0.0443 | 0.3750 | 8.9 | 3gjb:A |
8 | 7eld:A | 1137 | 21 | 0.1525 | 0.0079 | 0.4286 | 9.4 | 7ele:A |
9 | 4b9e:A | 297 | 23 | 0.1525 | 0.0303 | 0.3913 | 9.5 | 4bau:A, 4bb0:A |