DYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQ
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ebt:K | 172 | 115 | 0.9914 | 0.6686 | 1.0000 | 9.65e-83 | 7ad8:G, 8ebu:K, 8ebx:K, 8eby:K, 6j44:A, 6lae:A, 6lae:B, 6ro4:G, 1xpa:A |
2 | 5a39:B | 115 | 100 | 0.2759 | 0.2783 | 0.3200 | 7.36e-12 | 5a39:A, 5a3d:A, 5a3d:B, 5g32:A, 5g32:B, 5g33:A, 5g33:B, 5g34:A, 5g34:B, 5g35:A, 5g35:B, 5lcl:A, 5lcl:B, 5lcm:A, 5lcm:B |
3 | 2epr:A | 48 | 21 | 0.0948 | 0.2292 | 0.5238 | 3.0 | |
4 | 5v3g:D | 170 | 62 | 0.1552 | 0.1059 | 0.2903 | 3.6 | 5egb:A, 5eh2:F, 5eh2:E, 5ei9:E, 5ei9:F, 5v3g:A |
5 | 7o9u:A | 153 | 49 | 0.1293 | 0.0980 | 0.3061 | 4.3 | |
6 | 2ytt:A | 46 | 18 | 0.0862 | 0.2174 | 0.5556 | 8.1 | |
7 | 8he5:O | 516 | 31 | 0.1121 | 0.0252 | 0.4194 | 8.4 | |
8 | 2lo3:A | 44 | 21 | 0.0603 | 0.1591 | 0.3333 | 8.9 | |
9 | 6tmf:W | 56 | 24 | 0.0776 | 0.1607 | 0.3750 | 9.1 | 6skf:Az, 6skg:Az, 6th6:Az |
10 | 2en7:A | 44 | 18 | 0.0862 | 0.2273 | 0.5556 | 9.9 | |
11 | 6lg0:B | 444 | 38 | 0.1034 | 0.0270 | 0.3158 | 9.9 | 6lg0:A, 6lg0:C, 6lg0:D, 6lg0:E, 6lg0:F |