BioLiP

>protein
DTRTLSQQYLDDVRSGAIVIEGDSAAVSELILKRDIPIPYSYIAQLFATPNAFGSGPACIICHGSNNPTHAYRGLNLSTC
DGLRNGSTEQPARAIFTPGEDPKNAIIGRRLRANRMPLGIAFNNPTDSAPILAIKEWILAGFTKEILPLFATDNTFGPDT
PHCTTCHFSNQEPPSFHELNLTTYEGIMLGADSVGVDNATKVIIPGDPEASKVFQHLTEDRMPPGIDPSEDRDHPNTQIL
FAWIKQGAKCE

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5mab:A	259	259	1.0000	0.9691	0.9691	0.0	5mab:B, 5mab:C, 5mvo:A, 5mvo:B, 5mvo:C
2	3uly:A	389	68	0.0717	0.0463	0.2647	1.1	3um0:A, 3um1:A, 3um1:D, 3um2:A, 3um2:D, 3um3:A
3	1dw0:A	112	23	0.0518	0.1161	0.5652	1.5	1dw0:B, 1dw0:C, 1dw1:A, 1dw1:B, 1dw1:C, 1dw2:A, 1dw2:B, 1dw2:C, 1dw3:A, 1dw3:B, 1dw3:C
4	7qg4:A	746	71	0.0916	0.0308	0.3239	1.6	7qe1:A, 7qe1:B, 7qe2:A, 7qe2:B, 7qea:A, 7qea:B, 7qee:A, 7qee:B, 7qef:A, 7qef:B, 7qg4:B
5	5c2v:D	770	25	0.0478	0.0156	0.4800	1.9	5c2v:A, 5c2w:A, 5c2w:D
6	2zew:B	147	33	0.0438	0.0748	0.3333	2.8	3oea:A, 3oea:B, 3oeb:A, 2zew:A, 2zex:A, 2zex:B, 2zey:B, 2zey:A
7	4xwh:A	720	91	0.0956	0.0333	0.2637	3.6
8	4r2w:D	251	32	0.0518	0.0518	0.4062	7.4	7q2w:FFF, 4r2w:A, 4r2w:B, 4r2w:C, 4r2w:E, 4r2w:F, 4r2x:C, 4r2x:D, 4r2x:E, 4r2x:F, 4r2x:A, 4r2x:B, 4yjk:D, 4yjk:F, 4yjk:A
9	2bru:B	364	26	0.0478	0.0330	0.4615	9.7	1x14:B, 1x15:B

[Back]