DTEIIIGICRKNIPGWKEINESYIEVKQIFSGLTNQLFVVSIVNELKHPRILFRIYGKHVKFYDSKVELDVFRYLSNINI
APNIIADFPEGRIEEFIDGEPLTTKQLQLTHICVEVAKNMGSLHIINSKRADFPSRFDKEPILFKRIYLWREEAKIQVSK
NNIDKELYSKILEEIDQLEELIMGGEKFSMERALELKLYSPAFSLVFAHNDLQENNLLQTQNNIRMIDYEYSAINFAGAD
IANYFCEYIYDYCSEKQPYFKFKYEDYPCEELRKLFISVYLSQTLQEQVMPSQQIVHIMTKAVEVFTLISHITWGLWSIA
VEFDFTEYANTRFTHYLQKKKELIDQGILPLNSWLFN
The query sequence (length=357) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3mes:B | 358 | 359 | 0.9972 | 0.9944 | 0.9916 | 0.0 | 3mes:A |
2 | 3c5i:D | 355 | 366 | 0.3669 | 0.3690 | 0.3579 | 4.41e-63 | 3c5i:C, 3c5i:A, 3c5i:B |
3 | 6yxs:A | 359 | 362 | 0.3669 | 0.3649 | 0.3619 | 1.77e-61 | 3fi8:A, 6yxt:A |
4 | 3lq3:A | 339 | 354 | 0.3109 | 0.3274 | 0.3136 | 1.28e-45 | 3feg:A |
5 | 2ckp:A | 316 | 347 | 0.3109 | 0.3513 | 0.3199 | 5.23e-45 | |
6 | 8bi5:A | 355 | 358 | 0.3137 | 0.3155 | 0.3128 | 8.95e-45 | 7a04:A, 7a04:B, 7a06:A, 5afv:A, 5afv:B, 8bi5:B, 8bi6:A, 8bi6:B, 4br3:A, 4br3:B, 4cg8:A, 4cg9:A, 4cga:A, 2ckq:A, 2ckq:B, 4da5:A, 4da5:B, 5eqe:A, 5eqe:B, 5eqp:A, 5eqp:B, 5eqy:A, 5eqy:B, 3f2r:A, 3f2r:B, 5ftg:A, 5fut:A, 3g15:A, 3g15:B, 7nb1:AAA, 7nb1:BBB, 7nb2:AAA, 7nb2:BBB, 7nb3:AAA, 7nb3:BBB, 5w6o:A, 5w6o:B, 3zm9:A, 3zm9:B |
7 | 1nw1:A | 365 | 356 | 0.2437 | 0.2384 | 0.2444 | 9.39e-29 | 1nw1:B |
8 | 8agy:A | 346 | 187 | 0.1289 | 0.1329 | 0.2460 | 4.41e-04 | |
9 | 4r78:A | 287 | 145 | 0.0896 | 0.1115 | 0.2207 | 0.31 | 4r7b:A, 4r7b:B |
10 | 2xq1:B | 494 | 123 | 0.0812 | 0.0587 | 0.2358 | 1.3 | 2xq1:C, 2xq1:D, 2xq1:E, 2xq1:F, 2xq1:G, 2xq1:H, 2xq1:I, 2xq1:J, 2xq1:K, 2xq1:L, 2xq1:M, 2xq1:N, 2xq1:O, 2xq1:P |
11 | 5imt:A | 460 | 79 | 0.0560 | 0.0435 | 0.2532 | 1.5 | |
12 | 2pyw:A | 417 | 47 | 0.0392 | 0.0336 | 0.2979 | 1.8 | 2pyw:B |
13 | 4r6g:A | 464 | 146 | 0.0952 | 0.0733 | 0.2329 | 1.8 | |
14 | 3r75:B | 622 | 47 | 0.0504 | 0.0289 | 0.3830 | 2.8 | 3r75:A, 3r76:A, 3r76:B |
15 | 7mq8:SY | 238 | 122 | 0.0924 | 0.1387 | 0.2705 | 2.8 | 7mq9:SY, 7mqa:SY |
16 | 3vkh:A | 3042 | 106 | 0.0812 | 0.0095 | 0.2736 | 2.9 | |
17 | 3lkk:B | 238 | 80 | 0.0588 | 0.0882 | 0.2625 | 2.9 | 3lkk:A, 3ll5:A, 3ll5:B, 3ll5:C, 3ll5:D |
18 | 7xpi:A | 363 | 102 | 0.0784 | 0.0771 | 0.2745 | 3.6 | 7ytl:A |
19 | 1eap:A | 213 | 24 | 0.0308 | 0.0516 | 0.4583 | 5.3 | 1a0q:L, 5ye3:A, 5ye4:B, 5ye4:D, 6z7y:C, 6z7y:A, 6z7z:C, 6z7z:A |
20 | 1jt2:A | 255 | 73 | 0.0588 | 0.0824 | 0.2877 | 9.6 |