DSLEPRLQRELERLQAALRQTEAREIEWREKAQDLALSLAQTKASVSSLQEVAMFLQASVLERDSEQQRLQDELELTRRA
LEKERLH
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6oqa:G | 87 | 87 | 1.0000 | 1.0000 | 1.0000 | 2.82e-53 | 6oqa:D, 6oqa:C, 6oqa:H |
| 2 | 5b7i:A | 1044 | 38 | 0.1609 | 0.0134 | 0.3684 | 0.77 | |
| 3 | 8flj:M | 970 | 38 | 0.1609 | 0.0144 | 0.3684 | 0.83 | 8flj:N |
umich.edu