BioLiP

>protein
DQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDA
YKVKSEKLAN

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2wty:B	97	90	1.0000	0.9278	1.0000	1.36e-60	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
2	4eot:A	92	88	0.8000	0.7826	0.8182	1.70e-44	4eot:B
3	7x5e:E	101	88	0.5667	0.5050	0.5795	5.77e-30	3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E
4	4par:C	314	92	0.2333	0.0669	0.2283	0.82	4par:B, 4par:A, 4par:D, 4pba:C, 4pba:B, 4pba:A, 4pba:D
5	6evq:A	70	27	0.1444	0.1857	0.4815	1.2	6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B
6	7x5e:B	106	80	0.2111	0.1792	0.2375	1.7	7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F
7	5vpe:D	67	61	0.2222	0.2985	0.3279	2.9	5vpe:B, 5vpf:B, 5vpf:D
8	4oht:A	455	38	0.1556	0.0308	0.3684	3.3	4oht:B, 4ywu:A, 4ywu:B, 4ywv:A, 4ywv:B
9	8gap:A	1012	79	0.2333	0.0208	0.2658	4.1	5c9h:A, 7lma:A, 7lmb:A, 7uy5:A, 7uy6:A
10	6d6v:A	980	79	0.2333	0.0214	0.2658	4.2	5c9h:B
11	4wzo:71	93	41	0.1333	0.1290	0.2927	6.3
12	7pt6:9	341	34	0.1222	0.0323	0.3235	6.7	7pt6:I, 7pt7:9
13	5lpi:C	134	24	0.1111	0.0746	0.4167	10.0	5lpi:D, 5lpi:A, 5lpi:B

[Back]