DPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQ
KLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDF
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gdf:A | 497 | 124 | 1.0000 | 0.2495 | 1.0000 | 6.97e-87 | 5d9i:A, 5d9i:B, 4e2i:A, 4e2i:B, 4e2i:C, 4e2i:D, 4e2i:E, 4e2i:F, 4e2i:G, 4e2i:H, 4e2i:I, 4e2i:J, 4e2i:K, 4e2i:L, 4fgn:A, 4fgn:B, 4gdf:B, 4gdf:E, 4gdf:F, 2h1l:A, 2h1l:B, 2h1l:C, 2h1l:D, 2h1l:E, 2h1l:F, 2h1l:G, 2h1l:H, 2h1l:I, 2h1l:J, 2h1l:K, 2h1l:L, 2itl:A, 2itl:B, 1n25:A, 1n25:B, 2nl8:A, 2ntc:A, 2ntc:B, 1svl:A, 1svl:B, 1svl:C, 1svm:A, 1svm:F, 1svm:B, 1svm:C, 1svm:D, 1svm:E, 1svo:A, 1svo:B |
2 | 3qfq:B | 120 | 115 | 0.5000 | 0.5167 | 0.5391 | 4.14e-37 | 3qfq:A, 3qfq:E |
3 | 4fb3:A | 115 | 114 | 0.4274 | 0.4609 | 0.4649 | 2.56e-29 | 4fb3:B, 4fb3:E |
4 | 1ox0:A | 414 | 31 | 0.1210 | 0.0362 | 0.4839 | 4.4 | 2alm:A, 1oxh:A, 1oxh:B, 1oxh:C, 1oxh:D |