DPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8b3p:LLL | 46 | 46 | 0.9565 | 0.9565 | 0.9565 | 1.22e-25 | 8b3o:KKK, 8b3o:LLL, 8b3o:MMM, 8b3o:NNN, 8b3o:OOO, 8b3p:NNN, 8b3p:OOO, 8ixl:A, 8ixl:N, 8ixl:V, 8ixl:DA, 8ixl:Z, 8jww:A, 8jww:N, 8jww:V, 8jww:DA, 8jww:Z |
2 | 7e9y:A | 563 | 25 | 0.1957 | 0.0160 | 0.3600 | 3.8 | |
3 | 2yhe:A | 639 | 20 | 0.2174 | 0.0156 | 0.5000 | 6.7 | 4av7:A, 4av7:B, 4av7:C, 4av7:D, 4av7:E, 4av7:F, 4axh:A, 4axh:B, 2yhe:B, 2yhe:C, 2yhe:D, 2yhe:E, 2yhe:F |
4 | 2zzv:A | 330 | 25 | 0.1957 | 0.0273 | 0.3600 | 7.2 | 2zzv:B, 2zzw:A, 2zzw:B, 2zzx:C |
5 | 4aj9:C | 682 | 37 | 0.3261 | 0.0220 | 0.4054 | 7.4 | 4aj9:A, 4aj9:B, 4aj9:D, 4bim:A, 4bim:B, 4bim:C, 4bim:D, 3ej6:A, 3ej6:B, 3ej6:C, 3ej6:D, 6nsw:A, 6nsw:B, 6nsw:C, 6nsw:D, 6nsy:A, 6nsy:B, 6nsy:C, 6nsy:D, 6nsz:A, 6nsz:B, 6nsz:C, 6nsz:D, 6nt0:A, 6nt0:B, 6nt0:C, 6nt0:D, 6nt1:A, 6nt1:B, 6nt1:C, 6nt1:D, 3zj4:A, 3zj4:B, 3zj4:C, 3zj4:D, 3zj5:A, 3zj5:B, 3zj5:C, 3zj5:D |
6 | 7vu2:A | 435 | 19 | 0.2174 | 0.0230 | 0.5263 | 7.9 | 7vu3:A |