DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWKCSAPKYIDYLMTWVQDQLDDETLFPFPKNFMSV
AKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5brk:A | 194 | 156 | 1.0000 | 0.7423 | 0.9231 | 1.53e-103 | 5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B |
2 | 2hjn:A | 206 | 160 | 0.5764 | 0.4029 | 0.5188 | 2.91e-52 | 5ncn:A |
3 | 5ncm:A | 183 | 151 | 0.4583 | 0.3607 | 0.4371 | 1.89e-42 | |
4 | 7k36:H | 177 | 138 | 0.2153 | 0.1751 | 0.2246 | 0.049 | |
5 | 5yf4:A | 129 | 128 | 0.2083 | 0.2326 | 0.2344 | 4.2 | |
6 | 7orj:A | 2129 | 57 | 0.1111 | 0.0075 | 0.2807 | 8.5 | |
7 | 3usf:B | 402 | 17 | 0.0556 | 0.0199 | 0.4706 | 8.9 | 2hp1:B |
8 | 3fq7:A | 427 | 17 | 0.0556 | 0.0187 | 0.4706 | 9.3 | 3fq7:B, 3fq8:A, 3fq8:B, 3fqa:A, 3fqa:B, 2gsa:A, 2gsa:B, 3gsb:A, 3gsb:B, 4gsa:A, 4gsa:B, 2hoz:A, 2hoz:B, 2hp1:A, 2hp2:A, 2hp2:B, 3usf:A |
9 | 5yvg:B | 764 | 71 | 0.1528 | 0.0288 | 0.3099 | 9.6 | |
10 | 2e7u:A | 424 | 17 | 0.0486 | 0.0165 | 0.4118 | 9.9 |