BioLiP

>protein
DLKFDDDWKKSNVAVHLASLFGWVIPSASPCPAFPDNASLFKVFSDRISENLAHFPTGPSADDPIWLYMLTWHMGLFACM
MFGQIGVQARKQGYFG

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yca:O	96	96	1.0000	1.0000	1.0000	5.08e-69
2	7dz7:O	97	91	0.4896	0.4845	0.5165	9.51e-29	7d0j:O, 7dz8:O
3	8wgh:O	89	92	0.4167	0.4494	0.4348	5.17e-24
4	8htu:O	90	92	0.4062	0.4333	0.4239	8.54e-23	7ksq:O, 7ku5:O, 7xqp:O
5	6zzx:O	87	78	0.4062	0.4483	0.5000	8.63e-22
6	6sl5:O	86	77	0.3854	0.4302	0.4805	1.43e-21
7	8j6z:O	86	88	0.3646	0.4070	0.3977	1.04e-19
8	7y5e:ON	92	74	0.3438	0.3587	0.4459	1.41e-16	7y5e:O2, 7y7a:O7, 7y7a:Oo
9	6fos:O	98	86	0.3646	0.3571	0.4070	4.52e-15	7blz:O, 8wey:O, 5zgb:O, 5zgh:O
10	5zji:O	76	92	0.3333	0.4211	0.3478	4.76e-13
11	8wm6:O	104	73	0.3333	0.3077	0.4384	8.44e-13	8wmv:O, 8wmw:O
12	7y7b:O	99	80	0.3021	0.2929	0.3625	1.85e-10	7y8a:O
13	7ui9:w	103	63	0.1771	0.1650	0.2698	0.46	5sva:X, 7uif:w, 7uig:w, 7uio:Aw, 7uio:Bw
14	7qqk:A	433	65	0.1771	0.0393	0.2615	0.70	7qqk:B, 7qqk:C, 7qqk:D
15	1l8x:B	354	35	0.1354	0.0367	0.3714	1.4
16	6qsi:A	525	42	0.1979	0.0362	0.4524	1.7	6qsi:B
17	9ayh:A	1056	40	0.1146	0.0104	0.2750	3.1	9ayg:A, 9ayj:A, 9ayk:A, 9ayl:A
18	2uw1:B	338	34	0.1458	0.0414	0.4118	3.7	2uw1:A
19	2c8s:A	149	53	0.1771	0.1141	0.3208	5.2
20	6bk5:A	323	37	0.1146	0.0341	0.2973	7.2
21	8rjc:7	179	13	0.0938	0.0503	0.6923	7.4	8bf9:G, 8btk:TC, 8rjd:7

[Back]