DLKCKWKECPESASSLFDLQRHLLKDHVSQDFKHPMEPLACNWEDCDFLGDDTASIVNHINAQH
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1zw8:A | 64 | 64 | 1.0000 | 1.0000 | 1.0000 | 1.39e-43 | |
2 | 2rpc:A | 155 | 75 | 0.3125 | 0.1290 | 0.2667 | 0.39 | 2ej4:A |
3 | 6cst:A | 446 | 25 | 0.1406 | 0.0202 | 0.3600 | 0.62 | 6brx:A, 6brx:B, 6bs1:A, 6bs1:B, 6cst:B, 3in5:A, 3in5:B, 7nv0:A, 7nv1:A, 2oh2:A, 2oh2:B, 3pzp:A, 3pzp:B, 5t14:A, 5t14:B, 4u6p:A, 4u6p:B, 4u7c:A, 4u7c:B, 5w2a:A, 5w2a:B, 5w2c:A, 5w2c:B, 2w7o:B, 2w7o:A, 2w7p:B, 2w7p:A |
4 | 2gli:A | 155 | 62 | 0.2656 | 0.1097 | 0.2742 | 1.1 | 7t91:A, 7t91:B |
5 | 2gli:A | 155 | 24 | 0.1406 | 0.0581 | 0.3750 | 2.8 | 7t91:A, 7t91:B |
6 | 1tf6:D | 182 | 61 | 0.2656 | 0.0934 | 0.2787 | 1.4 | 2hgh:A, 2j7j:A, 1tf3:A, 1tf6:A, 1un6:C, 1un6:B, 1un6:D |
7 | 7wx5:A | 288 | 66 | 0.2656 | 0.0590 | 0.2576 | 1.5 | 7wx6:A, 7wx7:A |
8 | 5l3t:A | 294 | 33 | 0.1875 | 0.0408 | 0.3636 | 4.2 | |
9 | 4qht:C | 248 | 52 | 0.1875 | 0.0484 | 0.2308 | 4.7 | 6luf:A, 6luf:B, 6luf:C, 6luf:D, 6luf:E, 6luf:F, 6luf:G, 4qht:A, 4qht:B, 4qht:D, 4qht:E, 4qht:F, 4qht:G |
10 | 7bre:B | 163 | 35 | 0.1719 | 0.0675 | 0.3143 | 5.2 | 7bre:E |