DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFV
DDIQIVKEMLFARKDFTVVRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRAS
EAASRLDEEMSEIRGEVQEA
The query sequence (length=180) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ded:A | 196 | 195 | 1.0000 | 0.9184 | 0.9231 | 3.47e-127 | 5ded:D, 5ded:B, 5ded:C, 5ded:E, 5ded:F, 5ded:G, 5ded:H, 5f2v:V, 5f2v:X, 5f2v:T, 5f2v:S, 5f2v:Y, 5f2v:O, 5f2v:Z, 5f2v:W, 5f2v:U, 5f2v:P, 5f2v:R, 5f2v:Q |
2 | 6ewz:A | 202 | 187 | 0.3111 | 0.2772 | 0.2995 | 4.19e-23 | 6ewz:B, 6ex0:A, 6ex0:B, 6fgx:A, 6fgx:B |
3 | 8fkw:SU | 562 | 108 | 0.1611 | 0.0516 | 0.2685 | 1.3 | 8fkv:SU, 8fkx:SU, 8fky:SU |
4 | 4d1q:H | 509 | 51 | 0.1000 | 0.0354 | 0.3529 | 1.5 | 4d1q:A, 4d1q:B, 4d1q:G |
5 | 8edg:A | 550 | 51 | 0.1000 | 0.0327 | 0.3529 | 1.5 | 6dww:A, 6dwy:A, 6dwz:A, 6dwz:E, 6dx0:A, 8eb5:A, 8edg:C, 8edg:I, 8edg:E, 8edg:G, 8edg:K, 8sjd:C, 8sjd:D, 8sjd:B, 8sjd:A |
6 | 5xnx:D | 321 | 119 | 0.1667 | 0.0935 | 0.2521 | 2.7 | 5xnx:C |
7 | 7ly7:B | 329 | 54 | 0.0778 | 0.0426 | 0.2593 | 5.4 | 7ly4:A, 7ly4:D, 7ly5:B, 7ly6:A |
8 | 5lbp:A | 196 | 41 | 0.0667 | 0.0612 | 0.2927 | 9.6 | 5l9k:A, 5l9k:B, 5l9q:A, 5l9q:B, 5lau:A |