BioLiP

>protein
DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4bxl:A	46	46	1.0000	1.0000	1.0000	1.09e-28	4bxl:B, 5k5g:B, 5k5g:C, 2otk:E, 2otk:F
2	8cpl:C	499	44	0.7391	0.0681	0.7727	5.76e-16	8cpl:A, 8cpl:B, 8cpl:D, 1lp1:B, 4uox:A, 4uox:B, 4uox:C, 4uox:D, 4uoy:A, 4uoy:B, 4uoy:C, 4uoy:D
3	5cbn:A	176	43	0.7174	0.1875	0.7674	6.75e-16
4	5h75:D	225	42	0.6957	0.1422	0.7619	1.90e-15	5h75:A, 5h75:B, 5h75:C, 1p3y:1
5	5h7d:E	113	44	0.6957	0.2832	0.7273	3.47e-15	5h7d:F, 5h7d:G, 5h7d:H, 5h7d:K, 5h7d:L, 5h7d:O, 5h7d:P
6	5coc:A	124	42	0.6739	0.2500	0.7381	1.81e-14
7	5ewx:B	214	42	0.6087	0.1308	0.6667	1.98e-12	5ewx:A
8	8jxr:C	341	43	0.5000	0.0674	0.5349	4.12e-09
9	6fgo:F	67	53	0.5870	0.4030	0.5094	5.21e-09	6fgo:E, 6fgo:G, 6fgo:H
10	7rxc:B	439	44	0.5000	0.0524	0.5227	9.54e-09	7rxd:B
11	8pvr:B	509	34	0.3043	0.0275	0.4118	0.97	8pvr:A
12	6fxc:Ab	226	39	0.2826	0.0575	0.3333	2.7	7bge:b, 8bh6:b, 8bh7:b, 8byv:b, 6fxc:Bb, 7kwg:b, 5li0:b, 5nd8:b, 5nd9:b, 5ngm:Ab, 7nhl:c, 7nhm:c, 8p2f:c, 8p2g:c, 8p2h:c, 7p48:b, 6s0x:b, 6s13:b, 8y38:b, 8y39:b, 6yef:b
13	5mob:A	193	34	0.2609	0.0622	0.3529	3.5	7z1q:A, 7z1r:D000, 7z1s:A
14	4c1t:A	396	48	0.3478	0.0404	0.3333	4.7	4c1u:A, 3zkk:A, 3zkl:A
15	7qep:M3	161	23	0.2391	0.0683	0.4783	6.4
16	6c9g:A	386	33	0.2826	0.0337	0.3939	8.7	6c9f:A, 6c9j:A, 6e4t:A, 6e4u:A, 6e4w:A, 7jhg:A, 5kq5:A, 7m74:A, 4qfg:A, 4qfr:A, 4qfs:A, 5t5t:A, 5ufu:A
17	6d6j:B	113	34	0.3043	0.1239	0.4118	8.8	6d6j:A

[Back]