BioLiP

>protein
DGDPITSTEEIPFDKKREFDPNMAPGTEKVVQKGEPGTKTITTPTTKNPMTGEKGEGEPTEKITKQPVDEIVHYGGEQIP
QGHKDEFDPNAPVDSKTEVPGKPGVKNPDTGEVVTPPVDDVTKYGPVDGDSITSTEEIPFDKKREFDPNMAPGTEKVVQK
GEPGTKTITTPTTKNPMTGEKVGEGKSTEKVTKQPVDEIVEYGPT

The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4fun:A	206	205	0.9707	0.9660	0.9707	1.24e-134	4fum:A, 4fuo:A, 4fup:A, 4fup:B
2	4fun:A	206	77	0.3463	0.3447	0.9221	6.91e-41	4fum:A, 4fuo:A, 4fup:A, 4fup:B
3	8deo:A	454	204	0.8390	0.3789	0.8431	2.18e-104	8deo:B, 8g1l:A, 7sie:A
4	8deo:A	454	77	0.3024	0.1366	0.8052	2.95e-32	8deo:B, 8g1l:A, 7sie:A
5	3tiq:B	214	197	0.6000	0.5748	0.6244	1.17e-81	3tiq:A
6	3tiq:B	214	77	0.2195	0.2103	0.5844	9.95e-21	3tiq:A
7	5lsj:G	102	46	0.0829	0.1667	0.3696	1.0	5lsj:N
8	1ttx:A	109	44	0.0683	0.1284	0.3182	1.9
9	7wrx:H	594	111	0.1366	0.0471	0.2523	2.3	7wrx:A, 7wrx:B, 7wrx:C, 7wrx:D, 7wrx:E, 7wrx:F, 7wrx:G, 7wrx:I, 7wrx:J, 7wrx:K, 7wrx:L
10	4xev:A	148	65	0.0829	0.1149	0.2615	2.4	3gm1:A, 3gm1:B, 4r32:A, 3u3f:A, 3u3f:B, 3u3f:C, 3u3f:D, 4xef:A, 4xef:D, 4xek:A, 4xev:D
11	3a09:A	490	92	0.1220	0.0510	0.2717	3.8	3vlu:A, 3vlv:A, 3vlw:A, 3vlw:B, 1y3n:A, 1y3p:A, 1y3q:A
12	4r43:A	601	21	0.0488	0.0166	0.4762	8.2	5i67:A, 4rcg:A, 4wie:A, 4wiu:A, 4wl8:A, 4wou:A, 4wpt:A, 4wpu:A, 4wpv:A

[Back]