DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDK
ILVQRH
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ded:C | 91 | 86 | 1.0000 | 0.9451 | 1.0000 | 2.81e-59 | 3ded:A, 3ded:B, 3ded:D, 3ded:E, 3ded:F |
2 | 2pls:I | 86 | 82 | 0.4070 | 0.4070 | 0.4268 | 3.88e-20 | 2pls:G, 2pls:H, 2pls:J |
3 | 2oai:A | 80 | 83 | 0.3953 | 0.4250 | 0.4096 | 1.16e-18 | 2r8d:A |
4 | 2p4p:B | 77 | 75 | 0.2558 | 0.2857 | 0.2933 | 1.98e-08 | |
5 | 5e1z:B | 169 | 65 | 0.2093 | 0.1065 | 0.2769 | 0.65 | 5e1x:A, 5e20:A |
6 | 3lae:A | 81 | 70 | 0.1860 | 0.1975 | 0.2286 | 0.69 | |
7 | 8adj:A | 515 | 44 | 0.2093 | 0.0350 | 0.4091 | 0.70 | 8adj:B, 8adj:C |
8 | 4ub9:A | 467 | 36 | 0.1628 | 0.0300 | 0.3889 | 0.82 | 4ub9:B, 4ub9:C, 4ub9:D, 4ub9:E, 4ub9:F, 4ub9:G, 4wgx:A |
9 | 5yx4:A | 232 | 52 | 0.1628 | 0.0603 | 0.2692 | 2.1 | |
10 | 8bns:A | 433 | 83 | 0.2442 | 0.0485 | 0.2530 | 2.5 | 8bns:B, 8bns:C, 8bns:D |
11 | 7zgz:X | 753 | 62 | 0.1977 | 0.0226 | 0.2742 | 3.6 | 8c7f:B |
12 | 2oas:A | 427 | 31 | 0.1395 | 0.0281 | 0.3871 | 4.3 | 2oas:B |
13 | 6xyw:AQ | 366 | 56 | 0.2209 | 0.0519 | 0.3393 | 4.7 | |
14 | 6kse:A | 607 | 50 | 0.1977 | 0.0280 | 0.3400 | 5.6 | 6kse:B |