DEDTYYLQVRGRENFEILMKLKESLELMEL
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wqj:C | 32 | 30 | 1.0000 | 0.9375 | 1.0000 | 2.93e-15 | |
2 | 2wtt:L | 46 | 28 | 0.9333 | 0.6087 | 1.0000 | 7.84e-14 | 2wqj:K, 2wqj:Z, 2wtt:N, 2wtt:O, 2wtt:P |
3 | 4d1l:F | 38 | 29 | 0.5667 | 0.4474 | 0.5862 | 1.71e-05 | 4cz5:C, 4cz6:D |
4 | 4mzr:A | 234 | 29 | 0.4333 | 0.0556 | 0.4483 | 0.015 | 4mzr:B, 4mzr:C, 4mzr:D, 3q01:A, 3q01:B, 3q05:A, 3q05:C, 3q05:B, 3q05:D, 3q06:A, 3q06:C, 3q06:D, 3q06:B, 3ts8:A, 3ts8:B, 3ts8:C, 3ts8:D |
5 | 7bwn:J | 280 | 25 | 0.4000 | 0.0429 | 0.4800 | 0.28 | 7bwn:O, 7bwn:C, 7bwn:M, 4gf6:B, 4w74:A, 4w74:B, 4w74:H, 4w74:C, 4w74:D, 4w74:E, 4w76:A, 4w76:B, 4w77:A, 4w77:B, 4w7a:A, 4w7a:B, 4w7c:B, 4w7d:A, 4w7f:A, 4w7r:A, 4w7r:B, 4w7r:C, 4w7r:D |
6 | 7fac:A | 524 | 19 | 0.2667 | 0.0153 | 0.4211 | 6.5 | |
7 | 6vmb:E | 481 | 28 | 0.3667 | 0.0229 | 0.3929 | 9.0 | 6fkf:D, 6fkf:F, 6fkh:F, 6fkh:B, 6fki:B, 6fki:D, 1kmh:B, 6vmb:D, 6vmb:F, 6vmd:E, 6vmd:D, 6vmd:F, 6vof:E, 6vof:F, 6vog:E, 6vog:F, 6voh:D, 6voh:F, 6voi:D, 6voi:E, 6voi:F, 6voj:D, 6voj:E, 6voj:F, 6vok:D, 6vok:E, 6vok:F, 6vol:D, 6vol:E, 6vol:F, 6vom:D, 6vom:E, 6vom:F, 6von:D, 6von:E, 6von:F, 6voo:E, 6voo:D, 6voo:F |