DEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDI
EFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHK
EKC
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ovc:A | 167 | 163 | 1.0000 | 0.9760 | 1.0000 | 2.58e-122 | 7nw1:AAA, 7nw1:BBB |
2 | 4lp7:D | 230 | 160 | 0.2331 | 0.1652 | 0.2375 | 1.5 | 4lp7:A, 4lp7:B, 4lp7:C |
3 | 6mfv:A | 641 | 109 | 0.1656 | 0.0421 | 0.2477 | 2.3 | 6mfv:B, 6mfv:C, 6mfv:D |
4 | 1tg7:A | 971 | 43 | 0.0798 | 0.0134 | 0.3023 | 4.5 | 1xc6:A |
5 | 2lul:A | 164 | 28 | 0.0736 | 0.0732 | 0.4286 | 7.5 | |
6 | 3og2:A | 986 | 33 | 0.0675 | 0.0112 | 0.3333 | 8.8 | 3ogr:A, 3ogs:A, 3ogv:A |
7 | 6d8v:A | 269 | 67 | 0.1411 | 0.0855 | 0.3433 | 9.4 | |
8 | 6j6h:v | 722 | 47 | 0.1043 | 0.0235 | 0.3617 | 9.5 | 6j6n:v, 6j6q:v |
9 | 1x33:C | 225 | 54 | 0.0859 | 0.0622 | 0.2593 | 10.0 | 1smv:A, 1smv:B, 1smv:C, 1vak:A, 1vb4:A, 2vq0:A, 2vq0:C, 2vq0:B, 1x33:A, 1x33:B, 1x35:A, 1x35:B, 1x35:C, 1x36:A |