BioLiP

>protein
DEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGDPVLQRIVDILYATDEGFVIP

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6evq:A	70	66	0.9844	0.9000	0.9545	1.37e-38	6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B
2	5m9e:B	71	49	0.3438	0.3099	0.4490	5.22e-07	5m9e:A, 5m9e:C, 5m9e:D
3	1y7i:B	262	34	0.1875	0.0458	0.3529	0.66	1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A
4	2wty:B	97	27	0.2031	0.1340	0.4815	0.84	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
5	4eot:A	92	27	0.2188	0.1522	0.5185	0.87	4eot:B
6	2ya1:A	981	30	0.2031	0.0133	0.4333	0.98	2j44:A, 2ya0:A, 2ya2:A
7	5jb2:A	670	28	0.1719	0.0164	0.3929	2.1	5jaj:A, 5jbg:A
8	2dq0:A	447	33	0.1719	0.0246	0.3333	3.0	2dq0:B, 2zr2:A, 2zr2:B
9	6qh4:C	138	51	0.2344	0.1087	0.2941	3.2	6qh4:A, 6qh4:B, 6qh4:D, 3rmu:A, 3rmu:B, 3rmu:C, 3rmu:D
10	6zu5:SJ0	164	36	0.2188	0.0854	0.3889	4.8
11	5dob:A	237	44	0.2031	0.0549	0.2955	5.3	5d5n:B, 5doc:A, 5doc:B, 5doe:B
12	7myl:B	158	24	0.1562	0.0633	0.4167	6.1	5ecc:A, 5ecc:B, 5ecx:A, 5ecx:B, 7myl:A, 7myl:C, 7myl:D, 7myl:E, 7myl:F, 7reg:A, 7reg:B, 7rgj:A, 7rgj:B
13	3acw:A	284	29	0.2031	0.0458	0.4483	6.6	3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A
14	1htw:A	158	22	0.1562	0.0633	0.4545	7.9	1htw:B, 1htw:C
15	5okl:B	558	28	0.1562	0.0179	0.3571	9.4

[Back]