DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGF
ESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1xs9:A | 129 | 116 | 1.0000 | 0.8992 | 1.0000 | 3.07e-85 | 1bl0:A |
2 | 7bef:G | 106 | 101 | 0.3966 | 0.4340 | 0.4554 | 7.29e-32 | 7beg:G |
3 | 1d5y:A | 288 | 101 | 0.4397 | 0.1771 | 0.5050 | 8.00e-31 | 1d5y:B, 1d5y:D, 1d5y:C, 7vwy:G, 7vwz:G, 7vwz:I |
4 | 7w5w:J | 107 | 98 | 0.3534 | 0.3832 | 0.4184 | 3.85e-27 | 7w5x:K, 7w5y:K |
5 | 4fe7:A | 380 | 97 | 0.1983 | 0.0605 | 0.2371 | 1.35e-05 | |
6 | 3w6v:A | 111 | 94 | 0.1724 | 0.1802 | 0.2128 | 0.005 | |
7 | 1wpk:A | 146 | 46 | 0.1379 | 0.1096 | 0.3478 | 0.010 | 1adn:A, 1eyf:A, 1u8b:A, 1zgw:A |
8 | 4hf1:A | 129 | 119 | 0.2328 | 0.2093 | 0.2269 | 0.13 | 4chu:A, 4hf1:B, 4hf2:A, 4hf2:B |
9 | 3ct8:A | 133 | 35 | 0.1466 | 0.1278 | 0.4857 | 1.2 | |
10 | 4chu:B | 127 | 66 | 0.1379 | 0.1260 | 0.2424 | 1.6 | |
11 | 4cic:A | 138 | 64 | 0.1379 | 0.1159 | 0.2500 | 2.1 | 4cic:B |
12 | 6zu5:LX0 | 98 | 70 | 0.1552 | 0.1837 | 0.2571 | 2.9 | |
13 | 8pnh:A | 386 | 65 | 0.1379 | 0.0415 | 0.2462 | 3.2 | |
14 | 8ro1:L2 | 362 | 76 | 0.1638 | 0.0525 | 0.2500 | 3.8 | |
15 | 7zw0:sh | 776 | 62 | 0.1810 | 0.0271 | 0.3387 | 4.5 | |
16 | 8c41:A | 720 | 63 | 0.1552 | 0.0250 | 0.2857 | 5.1 | 8c41:B |
17 | 6u9w:A | 562 | 61 | 0.1638 | 0.0338 | 0.3115 | 5.5 | 8tr5:A, 8tr5:B, 8tr5:C, 8trj:A, 8trj:C, 8trj:B, 6u9v:A, 6u9v:B, 6u9v:C, 6u9w:B, 6u9w:C, 8v4s:A, 8v4s:B, 8v4s:C |
18 | 1b02:A | 279 | 79 | 0.1552 | 0.0645 | 0.2278 | 6.0 |