DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFSKNYITENLSCMTLSFKNLRAHQIAQLLRAA
GDATKDGFLKEISLVVTEHDGDVEAIEVFSMKFIYFENGGVVARLEDPHFAELAQLRYEGAESVRDQMVTIVRSVQFLCT
KVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPDGIQSVTIGHLRPGHHAAHMQCWSKSM
The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4tzm:A | 239 | 228 | 1.0000 | 0.9540 | 1.0000 | 8.93e-175 | 4tzl:A, 4tzl:B, 4tzm:B, 4tzn:A, 4tzn:B, 4tzs:A, 4tzs:B |
2 | 4tzq:C | 237 | 235 | 0.8421 | 0.8101 | 0.8170 | 6.15e-145 | 4tzo:A, 4tzo:C, 4tzo:E, 4tzo:G, 4tzq:A |
3 | 1gpl:A | 432 | 89 | 0.1009 | 0.0532 | 0.2584 | 0.19 | |
4 | 1hpl:A | 449 | 62 | 0.0833 | 0.0423 | 0.3065 | 0.20 | 1hpl:B |
5 | 1lpa:B | 449 | 62 | 0.0833 | 0.0423 | 0.3065 | 0.62 | 1lpb:B |
6 | 4n6k:A | 311 | 64 | 0.0789 | 0.0579 | 0.2812 | 7.6 | |
7 | 1eth:A | 448 | 60 | 0.0746 | 0.0379 | 0.2833 | 9.1 | 1eth:C |
8 | 5tmb:A | 451 | 40 | 0.0658 | 0.0333 | 0.3750 | 9.8 | 6bk0:A, 6bk1:A, 6bk2:A, 6bk3:A, 5tmd:A, 5tme:A |