CTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRST
The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6o5k:A | 46 | 43 | 1.0000 | 0.9348 | 1.0000 | 9.57e-26 | 6o5k:B |
2 | 2mvw:A | 51 | 30 | 0.3256 | 0.2745 | 0.4667 | 0.008 | 6imq:A, 6imq:B, 6imq:C, 6imq:D, 2mvw:B |
3 | 6uib:A | 132 | 30 | 0.2558 | 0.0833 | 0.3667 | 1.7 | |
4 | 2cup:A | 101 | 35 | 0.2326 | 0.0990 | 0.2857 | 3.1 | |
5 | 7aap:C | 67 | 39 | 0.3023 | 0.1940 | 0.3333 | 4.2 | 7ctt:C |
6 | 8vxa:A | 1139 | 29 | 0.2791 | 0.0105 | 0.4138 | 4.6 | 8vxc:A |
7 | 8vxy:B | 1161 | 29 | 0.2791 | 0.0103 | 0.4138 | 4.6 | |
8 | 6pe2:A | 456 | 11 | 0.1628 | 0.0154 | 0.6364 | 5.0 | 6p5a:A, 6p5a:G, 6pe2:G |
9 | 4oku:B | 241 | 19 | 0.2093 | 0.0373 | 0.4737 | 5.5 | 4okr:A, 4okr:B, 4oku:A |
10 | 7p1g:M | 347 | 26 | 0.2558 | 0.0317 | 0.4231 | 7.5 | 7p1g:K, 7p1g:L, 7p1g:N, 7p1g:O |
11 | 5xy3:U | 97 | 27 | 0.1628 | 0.0722 | 0.2593 | 8.2 |