CTAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVANDYPLYFDAINEDGLGMAGLNFP
GNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARNLVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTKSGVHI
YDNPIGILTNNPEFNYQMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSSKGMTV
EEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQIVAVTLNKDDGNRLVTYPFERKQIINK
L
The query sequence (length=321) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5y7p:A | 327 | 322 | 1.0000 | 0.9817 | 0.9969 | 0.0 | 8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F |
2 | 7svj:B | 326 | 324 | 0.5078 | 0.5000 | 0.5031 | 3.79e-114 | |
3 | 8etf:C | 330 | 322 | 0.4299 | 0.4182 | 0.4286 | 3.36e-87 | 8esg:A, 8esg:H, 8etf:H, 8etf:A, 8etf:B, 8etf:D, 8etf:E, 8etf:F, 8etf:G, 8fao:H, 8fao:A, 8fao:B, 8fao:C, 8fao:D, 8fao:E, 8fao:F, 8fao:G |
4 | 2bjf:A | 328 | 328 | 0.3769 | 0.3689 | 0.3689 | 2.14e-70 | 2rlc:A |
5 | 8etk:A | 321 | 319 | 0.3676 | 0.3676 | 0.3699 | 3.14e-69 | 8etk:B, 8ewt:A, 8ewt:B, 7svg:A, 7svg:D |
6 | 8vsy:B | 320 | 314 | 0.3489 | 0.3500 | 0.3567 | 1.44e-62 | 8u7n:B, 8vrx:B, 8vsy:A |
7 | 8esi:A | 316 | 306 | 0.3364 | 0.3418 | 0.3529 | 1.64e-59 | 8esi:B, 8esi:C, 8esi:D, 8esi:E, 8esi:F, 8esi:G, 8esi:H, 8ete:A, 8ete:B |
8 | 2z71:C | 331 | 329 | 0.3240 | 0.3142 | 0.3161 | 3.47e-50 | 2z71:A |
9 | 8esl:A | 309 | 167 | 0.1308 | 0.1359 | 0.2515 | 0.30 | 8esl:B, 8esl:C, 8esl:D |
10 | 6uh4:B | 326 | 297 | 0.1838 | 0.1810 | 0.1987 | 0.36 | |
11 | 8wte:D | 239 | 98 | 0.0810 | 0.1088 | 0.2653 | 1.4 | 7na5:E, 8wte:B, 8wul:D, 8wul:B, 8wul:F, 8wul:H |
12 | 8b2a:BBB | 238 | 45 | 0.0498 | 0.0672 | 0.3556 | 9.1 | 8b2a:AAA, 1sfj:A, 1sfj:B, 6sfh:A, 6sfh:B |