CAEFRIKYVGAIEKLGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVIKRHALYLIIRMVCYDDSLLALKTTEYSLWV
YQCNSLEQAQAICKVLSTAFDS
The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4dx9:O | 102 | 102 | 1.0000 | 1.0000 | 1.0000 | 4.70e-73 | 4dx9:a |
2 | 4jif:A | 130 | 129 | 0.9804 | 0.7692 | 0.7752 | 3.54e-60 | 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y |
3 | 4dx9:0 | 110 | 116 | 0.9020 | 0.8364 | 0.7931 | 3.53e-55 | 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U |
4 | 4dx9:y | 93 | 108 | 0.7941 | 0.8710 | 0.7500 | 2.07e-44 | |
5 | 4dx9:2 | 91 | 102 | 0.7353 | 0.8242 | 0.7353 | 5.54e-44 | |
6 | 4dx9:o | 63 | 81 | 0.4706 | 0.7619 | 0.5926 | 2.04e-16 | |
7 | 2zjf:A | 346 | 39 | 0.1569 | 0.0462 | 0.4103 | 0.27 | |
8 | 2d62:A | 375 | 59 | 0.2059 | 0.0560 | 0.3559 | 1.4 | |
9 | 6st5:A | 913 | 24 | 0.0980 | 0.0110 | 0.4167 | 2.3 | |
10 | 1g29:1 | 372 | 35 | 0.1373 | 0.0376 | 0.4000 | 4.7 | 1g29:2 |
11 | 7qep:S1 | 209 | 37 | 0.1275 | 0.0622 | 0.3514 | 5.8 | |
12 | 5vit:A | 548 | 83 | 0.2255 | 0.0420 | 0.2771 | 9.3 | 5vit:P, 5vit:I, 5vit:V |