CAEFRIKYVGAIEKLEGPLDLINYIDVAQQDGKLFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGL
GAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVL
The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jif:A | 130 | 130 | 0.9921 | 0.9692 | 0.9692 | 7.95e-88 | 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y |
2 | 4dx9:0 | 110 | 128 | 0.8504 | 0.9818 | 0.8438 | 4.21e-66 | 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U |
3 | 4dx9:O | 102 | 128 | 0.7717 | 0.9608 | 0.7656 | 1.09e-56 | 4dx9:a |
4 | 4dx9:2 | 91 | 127 | 0.7087 | 0.9890 | 0.7087 | 9.99e-49 | |
5 | 4dx9:y | 93 | 127 | 0.7087 | 0.9677 | 0.7087 | 1.82e-48 | |
6 | 4dx9:o | 63 | 121 | 0.4488 | 0.9048 | 0.4711 | 6.53e-15 | |
7 | 3lqv:B | 115 | 87 | 0.1496 | 0.1652 | 0.2184 | 7.2 | 2f9j:B, 3lqv:A, 7q4o:F, 8qo9:B6, 8qxd:B6, 8qzs:B6, 8r08:B6, 8r09:B6, 8r0a:B6, 8r0b:B6, 8rm5:B6 |